DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and Y53F4B.1

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_497085.2 Gene:Y53F4B.1 / 190206 WormBaseID:WBGene00013149 Length:463 Species:Caenorhabditis elegans


Alignment Length:456 Identity:80/456 - (17%)
Similarity:132/456 - (28%) Gaps:182/456 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KWGNDLLSNIQQLDWSD-----------LNEDVVLSLLRWIYTDLIDLQNDGLALDLLKAAHRFG 151
            ||     .|:||....|           ...|.||......||   |.:.:.:..:....|    
 Worm    20 KW-----DNVQQFKLGDGSYADVFHVFYKGHDAVLKRSIKEYT---DKERENIRREARVVA---- 72

  Fly   152 LPSLLGICERALVTSVGVRSCIRFYCVAEEVG-ASTLLEYCSSIISTHWDDLTTDDFQHMSGP-- 213
               .|..||          :.:|.|.:.|.:. ...::|||                   :||  
 Worm    73 ---ALNNCE----------NVVRIYGICETLPFRGMIMEYC-------------------AGPNL 105

  Fly   214 --LLFEMLKTKTKHPLHAAVRLLREDVVSLCIQKYGNSLVNTFSENGILPLEMALSSKNAKIAK- 275
              |:|::.:.|.|..             :|.|.|:.:.|..|..|..:......:.:||..:.: 
 Worm   106 SELVFQLDECKVKFE-------------TLRIFKWCHDLTRTLCELNVTYYHGDVKAKNVLVKER 157

  Fly   276 --SLVDNGMANI-------------NAVNMEGFSL-----------LKSALKNGDA--FSA---- 308
              ..|:....|:             |.|::|..||           ....|.||..  |||    
 Worm   158 PCCCVEGIYENVKIRNTTYSLCTICNGVHLEHLSLKICDFGMSYEHKDKRLYNGGTREFSAPETI 222

  Fly   309 ----------------------------NFLLDQNCLLDLPSKPSSDTA---LHIIC---NYGPD 339
                                        :..:.|...|.:.:....|.:   .:.||   .:..:
 Worm   223 RGIYTEKSEVYSFGHLMLVLVIGGPTEDDCAVGQRAFLKMYNNKKYDMSGCKSNSICETIEWCLN 287

  Fly   340 NTPEIMEVVKKILQ-----------------RQLNINIQNIKGETPLHIAIARRNVEMVKLLLKV 387
            ||.|.....|::|.                 |:|..|  |.:.|...|..|.|:           
 Worm   288 NTQESRPTFKQLLSKLNSRHTHYLSLRGTDTRRLEAN--NEREEFLDHYRIPRK----------- 339

  Fly   388 PNIDINLRTYDEKCALELSLSMGDHEFLIASILLSMGARTDRTNSKTGDSLLQVFALDRHRGEKS 452
              |.::.||......:.||.:.|.::.:..:....:|          |..:.|:|..|......|
 Worm   340 --ISVHRRTTTTSTCISLSETSGSNQDISVTSAAYLG----------GPIVNQMFIADTPLASPS 392

  Fly   453 A 453
            |
 Worm   393 A 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045 16/76 (21%)
BTB 75..166 CDD:197585 16/78 (21%)
ANK 252..385 CDD:238125 35/216 (16%)
ANK repeat 291..322 CDD:293786 11/75 (15%)
ANK repeat 325..362 CDD:293786 11/59 (19%)
Ank_2 330..431 CDD:289560 22/120 (18%)
ANK 463..595 CDD:238125
ANK repeat 468..501 CDD:293786
Ank_2 473..572 CDD:289560
ANK repeat 503..539 CDD:293786
ANK 536..660 CDD:238125
ANK repeat 541..572 CDD:293786
ANK repeat 574..637 CDD:293786
Ank_2 579..670 CDD:289560
ANK repeat 639..670 CDD:293786
Ank_2 644..752 CDD:289560
ANK repeat 672..721 CDD:293786
ANK 721..843 CDD:238125
ANK repeat 723..752 CDD:293786
ANKYR 752..977 CDD:223738
ANK repeat 754..786 CDD:293786
ANK 820..944 CDD:238125
ANK repeat 822..855 CDD:293786
ANK repeat 857..888 CDD:293786
ANK 885..1017 CDD:238125
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786
FYVE_ANFY1 1054..1116 CDD:277267
Y53F4B.1NP_497085.2 PKc 29..303 CDD:270622 54/325 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.