DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41099 and RIPK3

DIOPT Version :9

Sequence 1:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster
Sequence 2:NP_006862.2 Gene:RIPK3 / 11035 HGNCID:10021 Length:518 Species:Homo sapiens


Alignment Length:175 Identity:34/175 - (19%)
Similarity:58/175 - (33%) Gaps:65/175 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   636 INKNGESPLWSALEK--GYEDVAKILVRHGIDTDC----------------------WDEGPEGC 676
            :.|.|...::.|..:  ||:...||:....|..:.                      ||:.|   
Human    27 VGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISREVKAMASLDNEFVLRLEGVIEKVNWDQDP--- 88

  Fly   677 RQTLLHRAIDENKESVAIFLIQSQCDLDSSRQPGPNGEGGDEAQDKASPLHLCCHWGQTKVLQTL 741
            :..|:.:.::....|   .|:||||.     :|.|                |.|...:..||...
Human    89 KPALVTKFMENGSLS---GLLQSQCP-----RPWP----------------LLCRLLKEVVLGMF 129

  Fly   742 IDHGANVNLIDAESKSPLHVAIESQYDEIISILLCHPDIDLKLRD 786
            ..|..|..|:..:.| |.:|.::             |::.:||.|
Human   130 YLHDQNPVLLHRDLK-PSNVLLD-------------PELHVKLAD 160

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
Ank_2 330..431 CDD:289560
ANK 463..595 CDD:238125
ANK repeat 468..501 CDD:293786
Ank_2 473..572 CDD:289560
ANK repeat 503..539 CDD:293786
ANK 536..660 CDD:238125 7/25 (28%)
ANK repeat 541..572 CDD:293786