DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Haspin and IRAK2

DIOPT Version :9

Sequence 1:NP_001015349.2 Gene:Haspin / 3355064 FlyBaseID:FBgn0046706 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001561.3 Gene:IRAK2 / 3656 HGNCID:6113 Length:625 Species:Homo sapiens


Alignment Length:282 Identity:57/282 - (20%)
Similarity:95/282 - (33%) Gaps:93/282 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MDFLEEGRWKDPFDELLDSRTKLSKMNIVK--QNVRVT-----------YNIDSSVENSSYIEIK 60
            ||.|.|..|.:....::...|:|.|:..::  |.|.:|           ..:...|:....:|:.
Human    20 MDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITRELLWWWGMRQATVQQLVDLLCRLELY 84

  Fly    61 EP-----NHKNEPLTLEDCSIKVYCP----SDSISTPCDKRLGGTTGLFETDLSPITRLKLEGVE 116
            ..     |.|..|        ::.||    .||:..             |..|:...|       
Human    85 RAAQIILNWKPAP--------EIRCPIPAFPDSVKP-------------EKPLAASVR------- 121

  Fly   117 DSRDKCADTNEADLYVNVEILFQNINSSPKKCSNFGKKRLSNLNKMVTAVHPSISLNPGKWRKSL 181
                |..|..|....|.: ..|....|||.:                  .|....|.|.:  :..
Human   122 ----KAEDEQEEGQPVRM-ATFPGPGSSPAR------------------AHQPAFLQPPE--EDA 161

  Fly   182 NNFIRSKITETNFTKKVERRSSICQDRKSLVLKGEHKFENKYEEDVLKYCHQCTPLPFNTAYEQH 246
            .:.:||.:..::.:|  :..:||.:..|.|.|.|:..|.:  |.||:    |.|. .||      
Human   162 PHSLRSDLPTSSDSK--DFSTSIPKQEKLLSLAGDSLFWS--EADVV----QATD-DFN------ 211

  Fly   247 KLLNTKKIGEGAYGEVFRCSRN 268
               ..:||.:|.:.:|:|..|:
Human   212 ---QNRKISQGTFADVYRGHRH 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HaspinNP_001015349.2 PKc_like 252..>426 CDD:304357 6/17 (35%)
DUF3635 479..>545 CDD:289128
IRAK2NP_001561.3 Death_IRAK2 3..91 CDD:176773 13/70 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..181 17/116 (15%)
STKc_IRAK2 216..504 CDD:271059 5/15 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.