DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Haspin and Irak1

DIOPT Version :9

Sequence 1:NP_001015349.2 Gene:Haspin / 3355064 FlyBaseID:FBgn0046706 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_006229660.1 Gene:Irak1 / 363520 RGDID:1563841 Length:711 Species:Rattus norvegicus


Alignment Length:349 Identity:69/349 - (19%)
Similarity:111/349 - (31%) Gaps:117/349 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 RLSNLNKMVTAVHPSISL----------------------NPGKWRKSLNNFIRSKITETNFTKK 197
            :|.....::||.||..|:                      :|.|.:.|.:.|:......:....:
  Rat    91 QLLRARDIITAWHPPASVLPPSTGAPRPSSISAGSETEDWSPRKLQSSASTFLSPAFPGSQTHSE 155

  Fly   198 VERRSSICQDRKSLVLKGE--HKFENKYEEDVLKYCHQCTPLPF---------NTAYEQHKLLNT 251
            .|.......|.....|:..  ...:....|..:....:..|.||         .|.....:|   
  Rat   156 SELLQVPLSDSLGPPLQSSAPSSIKQPSPESPVSGLQRARPSPFCWPFCEISQGTCNFSEEL--- 217

  Fly   252 KKIGEGAYGEVFRC-SRNQ----EVLKDHISDIVLKIIPLEGSTVINGEKQKTFSQILPEIIITK 311
             :||||.:|.|:|. .||.    :.||:. :|:...::  :.|.:...|:...|..  |.|:...
  Rat   218 -RIGEGGFGCVYRAVMRNTTYAVKRLKEE-ADLEWTVV--KQSFLTEVEQLSRFRH--PNIVDFA 276

  Fly   312 KMCSLRTSKTNSTNGFVSIQKVSLVKGRYPPHFIKLWEKYDNEKGSENDHPELFGDNQLFAVLEL 376
            ..|        :.:||     ..||.|..|             .||..|.            |.|
  Rat   277 GYC--------AESGF-----YCLVYGFLP-------------NGSLEDQ------------LHL 303

  Fly   377 KFAGSDMANFKFLNSEQSYYALQQIILALAVGEEEYQFEHRD----LHLGNILIEYTNKKHIVCT 437
            :....         |..|:.....|:|..|   ...||.|:|    :| |:|             
  Rat   304 QTQAC---------SPLSWPQRLDILLGTA---RAIQFLHQDSPSLIH-GDI------------- 342

  Fly   438 FKSSNLTLLSKGVNVTIIDYTLSR 461
             ||||: ||.:.:...:.|:.|:|
  Rat   343 -KSSNV-LLDERLMPKLGDFGLAR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HaspinNP_001015349.2 PKc_like 252..>426 CDD:304357 41/182 (23%)
DUF3635 479..>545 CDD:289128
Irak1XP_006229660.1 Death_IRAK1 17..100 CDD:260061 1/8 (13%)
PKc_like 219..522 CDD:304357 50/217 (23%)
STYKc 219..519 CDD:214568 50/217 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.