DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Haspin and Irak2

DIOPT Version :9

Sequence 1:NP_001015349.2 Gene:Haspin / 3355064 FlyBaseID:FBgn0046706 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001020593.1 Gene:Irak2 / 362418 RGDID:1309584 Length:624 Species:Rattus norvegicus


Alignment Length:405 Identity:85/405 - (20%)
Similarity:139/405 - (34%) Gaps:133/405 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KEPNHKNEPLTLEDCSIKV---------YCPSDSISTPCDKRLGGTTG--LF--ETDLSPITRLK 111
            :.|..::.|     ||:|.         ||   |.|.|..::|....|  ||  |.|:       
  Rat   154 QRPCEEDAP-----CSLKTDVPDSLQSKYC---STSIPKQEKLLNLPGDRLFWSEADI------- 203

  Fly   112 LEGVE--DSRDKCADTNEADLY----VNVEILFQNI----NSSPKKCSNFGKKRLSNLNKMVTAV 166
            ::..|  |...:.::...||:|    ..|...|:.:    .|||.....|.:   :.:...:...
  Rat   204 VQATEDFDQSHRISEGTFADIYRGQRNGVAFAFKRLREVTGSSPGSMDRFLQ---AEMQLCLRCC 265

  Fly   167 HPSI----SLNPGKWRKSL------NNFIRSKITETNFTKKVE--RRSSICQDRKSLVLKGEHK- 218
            ||:|    ....|:...||      |..::.::.....:..:.  :|:|||   ..|:|..||. 
  Rat   266 HPNILPLLGFCTGRQFHSLIYPYMANGSLQDRLWAQGDSDMLSWPQRASIC---SGLLLAVEHLH 327

  Fly   219 -----FENKYEEDVL-------KYCHQCT-PLPFN----------------TAYEQHKLLN---- 250
                 ..|....:||       |..|... |.|.|                .||.....:.    
  Rat   328 SLDIIHSNVKSANVLLDQHLNPKLAHPVAHPCPTNKKTKYTVMKTHLFQASAAYLPENFIRVGQL 392

  Fly   251 TKKIGEGAYGEVFRCS-RNQEVL-------KD----HISDIVLKIIPLE-----------GSTVI 292
            ||::      ::|.|. ...|||       ||    ::.|::|..||..           |..|:
  Rat   393 TKQV------DIFSCGIVLAEVLTGIPAMDKDRSPVYLKDLLLSEIPSNTSSVHSRKTSMGKVVV 451

  Fly   293 NGEKQKTFSQ---ILPEII----ITKKMCSLRTSKTNSTNGFVSIQKV-SLVKGRYPPHFIKL-W 348
            ....||...:   :|||..    .|.....||..:.:.....||:..| ..::|:     :.| |
  Rat   452 KEICQKHLERKAGLLPEACAETWATAVSVCLRRREASLEEARVSMAGVEEQLRGQ-----LSLPW 511

  Fly   349 EKYDNEKGSENDHPE 363
            .:...:.||.::.||
  Rat   512 SRVSEDTGSSSNTPE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HaspinNP_001015349.2 PKc_like 252..>426 CDD:304357 32/144 (22%)
DUF3635 479..>545 CDD:289128
Irak2NP_001020593.1 Death_IRAK2 3..91 CDD:176773
PKc_like 216..504 CDD:419665 60/299 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 508..536 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 549..593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346689
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.