DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Haspin and Irak3

DIOPT Version :9

Sequence 1:NP_001015349.2 Gene:Haspin / 3355064 FlyBaseID:FBgn0046706 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001101571.1 Gene:Irak3 / 314870 RGDID:1308846 Length:610 Species:Rattus norvegicus


Alignment Length:520 Identity:96/520 - (18%)
Similarity:172/520 - (33%) Gaps:151/520 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PCDKRLGGTTG----LFETDLSPITRLKLEGVEDSRD--------------KCADTNEADLYVNV 134
            ||..|  ||..    ||  ||.|....:|..:.||.|              ...|....:.||:.
  Rat     4 PCGAR--GTLSPHSLLF--DLPPALLGELCTILDSCDGPLGWRGLAERLSNSWLDVRHIEKYVHQ 64

  Fly   135 ------EILFQNINSSPKKCSNFGKKRLSNLNKM--VTAVHPSISLNPG-KWRKSLNNFIRSKIT 190
                  |:|:    |..:|....| ..|..|::|  ..|:|  :.:|.| .|...:...     .
  Rat    65 GKSGTRELLW----SWAQKNKTIG-DLLQVLHEMGHQRAIH--LIMNYGVNWTPPVQTH-----H 117

  Fly   191 ETNFTKKVERRSSICQDRKSLVLKGEHKFENKYEEDVLKYCH-------QCTPLPFNTAYEQHKL 248
            |..|.........:|::..    .|..:..|...::||...|       ..||:.|.:..|..|.
  Rat   118 ELRFPNLPPNSKPVCRESD----PGPLELANVTVDNVLVPEHNERGVVLHKTPISFQSILEGTKH 178

  Fly   249 LNTK-KIGEGAYGEVFRCS-RNQEVLKDHISDIVLKIIPLEGSTVINGEKQKTFSQILPEIIIT- 310
            .:.. .||||...||:|.. |||        ...:|:...|.:..:....::..|::  |:::. 
  Rat   179 FHKDFLIGEGEIFEVYRVEIRNQ--------TYAVKLFKQEKTMQLKKHWKRFLSEL--EVLLLF 233

  Fly   311 --KKMCSLRTSKTNSTNGFVSIQKVSLVKGRYPPHFIKLWEKYDNEKGSENDHPELFGDNQLFAV 373
              ..:..|...       |..::|:.||   ||                      ...:..||..
  Rat   234 NHPHILELAAY-------FTEMEKLCLV---YP----------------------YMSNGTLFDR 266

  Fly   374 LELKFAGSDMANFKFLNSEQSYYALQQIILALAVGEEEYQFEHRDLHLGNILIEYTNKKHIVCTF 438
            |:.....:.:          |::....:::.:|   :..|..|.           |....::|..
  Rat   267 LQCTNGTTPL----------SWHVRISVLIGIA---KAIQCLHN-----------TRPCAVICGN 307

  Fly   439 KSSNLTLLSKGVNVTIIDYTLSRVTINDCCYFN-DLSRDEELFQATGDYQYDVYRMMRNELKNNW 502
            .||        .|:.:.|....::|.....:|. .|.:.......||..:..::.|....::.  
  Rat   308 ISS--------ANILLDDQFQPKLTDFAAAHFRPHLEQQSSTINMTGSGRKHLWYMPEEYIRQ-- 362

  Fly   503 SSFSPKTNIIWLSYVIVKVLDSVKYKSINTKVHRMYIDKIK--ELKNIIMTF---ESASHCANYL 562
            ...:.||::.....||::||...|          :.:|..|  :|::::|..   .....|.::|
  Rat   363 GRLTIKTDVYSFGIVIMEVLTGCK----------VVLDDPKHVQLRDLLMELVEKRGLDSCLSFL 417

  Fly   563  562
              Rat   418  417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HaspinNP_001015349.2 PKc_like 252..>426 CDD:304357 28/178 (16%)
DUF3635 479..>545 CDD:289128 12/67 (18%)
Irak3NP_001101571.1 Death_IRAK-M 15..102 CDD:260062 22/95 (23%)
Pkinase 179..455 CDD:278497 53/325 (16%)
PK_IRAK3 185..460 CDD:271062 53/319 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346690
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.