DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Haspin and ZK177.2

DIOPT Version :9

Sequence 1:NP_001015349.2 Gene:Haspin / 3355064 FlyBaseID:FBgn0046706 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_495058.1 Gene:ZK177.2 / 191236 WormBaseID:WBGene00022670 Length:296 Species:Caenorhabditis elegans


Alignment Length:250 Identity:55/250 - (22%)
Similarity:112/250 - (44%) Gaps:49/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 VLKGEHKFENKYEEDVLKYCHQCTPLPFNTAYEQHKLLNTKKIGEGAYGEVFRCSRNQEVLKDHI 276
            |.||.||..|.    :::.......:|::.|..|.|    |.:|:||.|..:..     |.:|  
 Worm    29 VSKGRHKDVNA----IVRETESKKIVPWSDAKVQIK----KFLGDGASGTAYLV-----VWED-- 78

  Fly   277 SDIVLKIIPLEGSTVINGEKQKTFSQILPEIIITKKMCSLRTSKTNSTNGFVSIQKVSLVKGRYP 341
            .::|:|         :.|...::.|.:..|::||:|:..|    :.|.:.|:.... |:|....|
 Worm    79 KEVVMK---------VTGIHPQSISVLHDELLITQKIGKL----SKSCHNFLPYHG-SIVISDLP 129

  Fly   342 PHFIKLWEKYDNEKGSE-NDHPELFGDNQLFAVLELKFAGSDMANFKFLNSEQSYYALQQIILAL 405
            ...:         :.|| .:|..:|          :.:.|:.:|:::..:..:....:.|::||:
 Worm   130 AKMM---------RNSECVNHLAIF----------MGYGGTVLADWRTSDYRRCITIMAQLVLAM 175

  Fly   406 AVGEEEYQFEHRDLHLGNILIEYTNKKHIVCTFKSSNLTLLSKGVNVTIIDYTLS 460
            .:..::.:|.|.|:::.||||..|.|:.|........:|:.:.|:...:||::.|
 Worm   176 RIANDKMKFVHGDIYMMNILIAPTTKRWIEYNIDGKTITIQTFGIIPQLIDFSKS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HaspinNP_001015349.2 PKc_like 252..>426 CDD:304357 35/174 (20%)
DUF3635 479..>545 CDD:289128
ZK177.2NP_495058.1 SPS1 58..>263 CDD:223589 46/216 (21%)
PKc_like 63..>196 CDD:304357 34/172 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1374355at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.