DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Haspin and F12A10.6

DIOPT Version :9

Sequence 1:NP_001015349.2 Gene:Haspin / 3355064 FlyBaseID:FBgn0046706 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_495046.1 Gene:F12A10.6 / 184374 WormBaseID:WBGene00017395 Length:125 Species:Caenorhabditis elegans


Alignment Length:111 Identity:24/111 - (21%)
Similarity:42/111 - (37%) Gaps:27/111 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DKRLGGTTGLFETDLSPITRL---------KLEGVEDSRDKCADT----------NEADLYVNVE 135
            :|:|.....|.:.:...|::|         .|.|.:..::|....          |..:|.:..:
 Worm    15 EKKLSQLQMLADPERHDISKLHTVAKRIGHNLNGSKRDKEKVRQAVEMVGAAKIFNSGNLPICWK 79

  Fly   136 ILFQNI-----NSSPKKCSNFGKKRL---SNLNKMVTAVHPSISLN 173
            ..|:..     ||.|..|...||.||   ||.:.::..|..:|:.|
 Worm    80 FQFRQFADLPENSIPAICRFAGKNRLPPTSNFHNILENVSSNIAKN 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HaspinNP_001015349.2 PKc_like 252..>426 CDD:304357
DUF3635 479..>545 CDD:289128
F12A10.6NP_495046.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.