DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Haspin and C26E6.1

DIOPT Version :9

Sequence 1:NP_001015349.2 Gene:Haspin / 3355064 FlyBaseID:FBgn0046706 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_498050.1 Gene:C26E6.1 / 182941 WormBaseID:WBGene00016137 Length:196 Species:Caenorhabditis elegans


Alignment Length:185 Identity:48/185 - (25%)
Similarity:74/185 - (40%) Gaps:39/185 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 IVLKIIPLEGSTVINGEKQKTFSQILPEIIITKKMCSLRTSKTNSTNGFVS--IQKV-SLVKGRY 340
            :.||::|...:|..||        .|.|:....|:.|:..|..|:.....|  ..|: :.|..:|
 Worm     4 VALKLVPRVNATSKNG--------CLKEVDNATKINSICESAPNTAKLLHSCIFPKIPTTVCSQY 60

  Fly   341 --PPHFIKLWEKYDNEKGSENDHPELFGDNQLFAVLELKFAGSDM-ANFKFLNSEQSYYALQQII 402
              .||               ..|..:|          ::..||:: ...||.:.||....:.|||
 Worm    61 SLSPH---------------KTHFAMF----------MEMCGSELTGRIKFKSDEQVKSVICQII 100

  Fly   403 LALAVGEEEYQFEHRDLHLGNILIEYTNKKHIVCTFKSSNLTLLSKGVNVTIIDY 457
            ..|....::..:.|.|.|..||||..|.|:.|....:.:...|.:.||.||:|||
 Worm   101 FFLVAARKKSGYSHNDFHKRNILINDTRKETICYKVEGTEYVLKTSGVWVTVIDY 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HaspinNP_001015349.2 PKc_like 252..>426 CDD:304357 35/152 (23%)
DUF3635 479..>545 CDD:289128
C26E6.1NP_498050.1 PKc_like 16..>133 CDD:304357 35/149 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6322
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.