DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Haspin and Y48B6A.10

DIOPT Version :9

Sequence 1:NP_001015349.2 Gene:Haspin / 3355064 FlyBaseID:FBgn0046706 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_496965.1 Gene:Y48B6A.10 / 175077 WormBaseID:WBGene00012981 Length:430 Species:Caenorhabditis elegans


Alignment Length:263 Identity:56/263 - (21%)
Similarity:105/263 - (39%) Gaps:44/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 KVERRSSICQDRKSLVLKGEHKFENKYEEDVLKYCHQCTPLPFNTAYEQHKLLNTKKIGEGAYGE 261
            |.||:.:..:.|::..|      |..:|:  ..|..:.|.......:...|:...:|:|.|..|:
 Worm   146 KNERQRASERARRAKAL------EKDFEQ--FGYLPEMTTKKKVVQWPAMKIELEQKLGGGIAGD 202

  Fly   262 VFRCSRNQEVLKDHISDIVLKIIPLEGSTVINGEKQKTFSQILPEIIITKKMCSLRTSKTNSTNG 326
            .|.|:...       .:.|.|||||..|    ...:|.|.    |:....::..:    .:.|..
 Worm   203 AFNCTWKG-------LERVAKIIPLHPS----HRNKKAFQ----EVAALNRLGDV----AHQTPN 248

  Fly   327 FVSIQKVSLVKGRYPPHFIKLWEKYDNEKGSENDHPELFGDNQLFAVLELKFAGSDMANF--KFL 389
            .|..:..::|.|.  |..:|            |...|.:..|.:..|: |...|..:|:.  ..|
 Worm   249 LVKFEMAAVVTGM--PQDVK------------NQLRENWRTNHMLVVI-LSRGGRPVASQPPDSL 298

  Fly   390 NSEQSYYALQQIILALAVGEEEYQFEHRDLHLGNILIEYTNKKHIVCTFKSSNLTLLSKGVNVTI 454
            .::||...::|.::.:.:||...:..|.|.|..|:|:..|:.:::........:.:.|....:||
 Worm   299 TAQQSIGIMKQFVMTMLIGETSLKLYHNDAHCRNVLLTDTDDEYLEYKPDGGAVKVKSYEKKLTI 363

  Fly   455 IDY 457
            ||:
 Worm   364 IDF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HaspinNP_001015349.2 PKc_like 252..>426 CDD:304357 39/175 (22%)
DUF3635 479..>545 CDD:289128
Y48B6A.10NP_496965.1 Pkinase_Tyr 189..>338 CDD:369480 40/182 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.