DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Haspin and W02H3.3

DIOPT Version :9

Sequence 1:NP_001015349.2 Gene:Haspin / 3355064 FlyBaseID:FBgn0046706 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001257133.1 Gene:W02H3.3 / 13222724 WormBaseID:WBGene00195208 Length:108 Species:Caenorhabditis elegans


Alignment Length:123 Identity:20/123 - (16%)
Similarity:51/123 - (41%) Gaps:36/123 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LFETDLSPITRLKLEGVEDSRDKCADTNEADLYVNVEILFQNINSSPKKCSNFGKKRLSNLNKMV 163
            |.|..::||    |:.:.::.|:.:...:|...:...::.:||           ::.|.....::
 Worm    13 LAELQVNPI----LDALNNAFDEFSRVVKARPSLTTAVIVENI-----------REELIGFVNVI 62

  Fly   164 TAVHPSISLNPGKWRKSLNNFIRSKITETNFTKKVERRSSICQDRKSLVLKGEHKFEN 221
            |     :.:|.|.....:|:.:.::    |.|:|:            :::..:.:|||
 Worm    63 T-----MQMNTGNVTGLVNHLLDAQ----NMTQKI------------IMVTRKIRFEN 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HaspinNP_001015349.2 PKc_like 252..>426 CDD:304357
DUF3635 479..>545 CDD:289128
W02H3.3NP_001257133.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.