DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and CSTF64

DIOPT Version :10

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_177325.2 Gene:CSTF64 / 843510 AraportID:AT1G71800 Length:461 Species:Arabidopsis thaliana


Alignment Length:89 Identity:27/89 - (30%)
Similarity:52/89 - (58%) Gaps:7/89 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YINNLPFDANEDDLYEFFEGIN-LISLRLPREDGENGRSRGFGYVELENREDLIHV-LSLPDPSI 145
            ::.|:|:||.|:.|.|....:. ::|.||. .|.|.|:.:|:|:.|.::.|..:.. .:|....|
plant    12 FVGNIPYDATEEQLREICGEVGPVVSFRLV-TDRETGKPKGYGFCEYKDEETALSARRNLQSYEI 75

  Fly   146 KGRRIRIELSNENDQ---QSRQKS 166
            .||::|::.: |||:   ::|.:|
plant    76 NGRQLRVDFA-ENDKGTDKTRDQS 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM_eIF4B 78..159 CDD:409836 23/77 (30%)
CSTF64NP_177325.2 RRM_CSTF2_RNA15_like 9..85 CDD:409832 22/73 (30%)
SF-CC1 <11..212 CDD:273721 27/89 (30%)
CSTF_C 419..454 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.