DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and NUC-L1

DIOPT Version :9

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_175322.1 Gene:NUC-L1 / 841314 AraportID:AT1G48920 Length:557 Species:Arabidopsis thaliana


Alignment Length:203 Identity:50/203 - (24%)
Similarity:84/203 - (41%) Gaps:37/203 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KKIRNLDGDDSDDGSGTLPLVYQLPTAPRANRIFDDNSIPHKAPFIAYINNLPFDANEDDLYEFF 100
            ||..:::..|::..|...|   :.|:.|.|.        ..|..|.|   ||.|:....|:..||
plant   267 KKSSDVEMVDAEKSSAKQP---KTPSTPAAG--------GSKTLFAA---NLSFNIERADVENFF 317

  Fly   101 -EGINLISLRLP--REDGENGRSRGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNENDQQS 162
             |...::.:|..  |:||.   .||||:||..:.|:....|......:.||.||::::.|..::.
plant   318 KEAGEVVDVRFSTNRDDGS---FRGFGHVEFASSEEAQKALEFHGRPLLGREIRLDIAQERGERG 379

  Fly   163 RQKS----NRRFDGFGNNGDNR-------DSGNWRRDSQNNGSNFGYSSNFERSFNRERKSLP-D 215
            .:.:    :..|...|:.||.:       |:.....|.:|.     ...:|......:..|:| |
plant   380 ERPAFTPQSGNFRSGGDGGDEKKIFVKGFDASLSEDDIKNT-----LREHFSSCGEIKNVSVPID 439

  Fly   216 RDDVNTPG 223
            ||..|:.|
plant   440 RDTGNSKG 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 42/167 (25%)
RRM_eIF4B 79..155 CDD:240848 25/78 (32%)
NUC-L1NP_175322.1 RRM1_NUCLs 298..375 CDD:240896 25/82 (30%)
RRM2_NUCLs 402..479 CDD:240897 11/51 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.