DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and AT4G20030

DIOPT Version :10

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_567594.1 Gene:AT4G20030 / 827748 AraportID:AT4G20030 Length:152 Species:Arabidopsis thaliana


Alignment Length:123 Identity:27/123 - (21%)
Similarity:53/123 - (43%) Gaps:27/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IFDDNSIPH---------KAPFIAY-------INNLPFDANEDDLYEFFEGINLIS-LRLPREDG 115
            :...:|:|:         ||....|       :.||||..:||.|...|.....|: ::|.:::.
plant    12 VASSSSLPNYRNLRFPKIKASLFNYPLASKIMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDEA 76

  Fly   116 ENGRSRGFGYVELENREDLIHVLSLPDPSI-KGRRIRIELSNENDQQSRQKSNRRFDG 172
            .. ||:|:.:::..:::|....:...|..: .||.|.|:::        :...|.|.|
plant    77 MK-RSKGYAFIQFTSQDDAFLAIETMDRRMYNGRMIYIDIA--------KPGKRDFQG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM_eIF4B 78..159 CDD:409836 21/89 (24%)
AT4G20030NP_567594.1 RRM 41..113 CDD:214636 18/72 (25%)

Return to query results.
Submit another query.