DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and Cirbp

DIOPT Version :9

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_006241075.3 Gene:Cirbp / 81825 RGDID:620756 Length:176 Species:Rattus norvegicus


Alignment Length:162 Identity:46/162 - (28%)
Similarity:75/162 - (46%) Gaps:32/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIH-VLSLPDPSIK 146
            ::..|.||.||..|.:.|.....||..:..:|.|..||||||:|..||.:|... ::::...|:.
  Rat     9 FVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVD 73

  Fly   147 GRRIRIELSNE-NDQQSR-------------QKSNRRFDGFGNNGDNRDSGNWR----------- 186
            ||:||::.:.: :|.:||             :....|..||...|.:|..|..|           
  Rat    74 GRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGS 138

  Fly   187 RD---SQNNGSNFGYSS---NFERSFNRERKS 212
            ||   |::.|.::||.|   ::..|::...||
  Rat   139 RDYYASRSQGGSYGYRSSGGSYRDSYDSYGKS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 46/162 (28%)
RRM_eIF4B 79..155 CDD:240848 26/72 (36%)
CirbpXP_006241075.3 RRM_CIRBP_RBM3 6..85 CDD:409883 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.