DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and Hnrnpd

DIOPT Version :10

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_077380.2 Gene:Hnrnpd / 79256 RGDID:620365 Length:353 Species:Rattus norvegicus


Alignment Length:129 Identity:34/129 - (26%)
Similarity:60/129 - (46%) Gaps:15/129 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YINNLPFDANEDDLYEFFEGINLI-SLRLPREDGENGRSRGFGYVELENREDLIHVL--SLPDPS 144
            ::..|..|..|:.:.|:|.|...: |:.||.::..|.| |||.::..:..|.:..::  ...:..
  Rat   183 FVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKR-RGFCFITFKEEEPVKKIMEKKYHNVG 246

  Fly   145 IKGRRIRIELSNENDQQSRQKSNRRFDGFGNNGDNRDSG---NWRRD-----SQNNGSNFGYSS 200
            :....|::.:|.|..||.:|..:|  .||......|..|   ||.:.     :|..|| :||:|
  Rat   247 LSKCEIKVAMSKEQYQQQQQWGSR--GGFAGRARGRGGGPSQNWNQGYSNYWNQGYGS-YGYNS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM_eIF4B 78..159 CDD:409836 18/78 (23%)
HnrnpdNP_077380.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89
CBFNT <55..76 CDD:311868
RRM1_hnRNPD 97..170 CDD:410150
RRM2_hnRNPD 181..255 CDD:241027 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.