DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and eif4ba

DIOPT Version :9

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001092707.2 Gene:eif4ba / 553214 ZFINID:ZDB-GENE-060629-1 Length:616 Species:Danio rerio


Alignment Length:506 Identity:142/506 - (28%)
Similarity:229/506 - (45%) Gaps:121/506 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASAGKKGKKNKGTVISLQSFLCN--------SDAPVGTTQVSKKIRNLDGD-----DSDDGSGT 52
            ||::.||.|| ||..::|..||..        |.||...|..:.:..:|:||     .::|....
Zfish     1 MAASAKKNKK-KGKTLTLTDFLAEDSGGNAPPSYAPPKPTSWADETDDLEGDVTTSWHTEDEVYR 64

  Fly    53 LPLVYQ--LPTAPRANR--IFDDNSIPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPRE 113
            .|.:.:  |||||||.|  ..|.:.:|...|:.|::.|||:|..||.:..||.|:::.::|||||
Zfish    65 APPIDRSILPTAPRAAREPNVDRSRLPRSPPYTAFLGNLPYDVTEDSIKNFFRGLSISAVRLPRE 129

  Fly   114 DGENGRSRGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNENDQQSRQKSNRRFDGFGNNGD 178
            .....|.:||||.|.::.|.|:..|||.:.::..||||:::::::::  :::.:|...|...|..
Zfish   130 PSNPERLKGFGYAEFDDVESLLQALSLNEENLGNRRIRVDIADQSNE--KERDDRSVSGRDRNRS 192

  Fly   179 NRDSG------NWR------------------------------RDSQ---NNGSNFGYSSNFER 204
            :||.|      :||                              |:.|   |:..:.|.....||
Zfish   193 DRDMGPDKTDSDWRARPKSEADDGPRRDDAFAERSKDRYDSDRHREGQRWDNDRYDGGRDRYRER 257

  Fly   205 SFNRERKSLPDRDDVNTPGSWRTSARPQSIDTSPTRREVEQVSEKYREGRVKIADRY-SREETSK 268
            ..:|||:......|..:.|     .||..   |..||:.:...:.:|..    .||| .|||..:
Zfish   258 YDDRERRDYDRGFDSRSGG-----RRPFG---SGFRRDYDDRRDDFRGS----GDRYGDREERFE 310

  Fly   269 VEEE---------RPKLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQGGTSS----LNVFGSAKP 320
            ..:|         |||||||||::|..:..:               :|.::|    .::||.|||
Zfish   311 RRDERRDDRGPPQRPKLNLKPRSVPKDEEPS---------------RGPSASSGRAASIFGGAKP 360

  Fly   321 VDTAARELEIEQRLALARKQDKGRREQGLNEKLAELQVDKN---DNESLSATVSWRT-------N 375
            |||||:|.|:|:|  |.::||:.:|         :|:.|||   :.:......|||:       :
Zfish   361 VDTAAKEREVEER--LKKEQDRLQR---------QLEEDKNRGPERKPRERHPSWRSEDQGTERS 414

  Fly   376 QDYKESDKINKCPGEKQRDEEIHRLNHARGQFNRPELLREKPNANGESKRD 426
            :...||.:....|...||..|..|........:|.|.|....:.:..||::
Zfish   415 RTGSESSQTGNPPSRGQRRRESERSVENEVFSSRDEELSSHGSQSPASKQE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 63/235 (27%)
RRM_eIF4B 79..155 CDD:240848 31/75 (41%)
eif4baNP_001092707.2 RRM <91..235 CDD:223796 40/145 (28%)
RRM_eIF4B 95..171 CDD:240848 31/75 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595132
Domainoid 1 1.000 68 1.000 Domainoid score I9709
eggNOG 1 0.900 - - E33208_3BDSB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I4369
OMA 1 1.010 - - QHG58965
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 1 1.000 - - FOG0007285
OrthoInspector 1 1.000 - - otm26060
orthoMCL 1 0.900 - - OOG6_105219
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1292
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.