DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and CG11726

DIOPT Version :9

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster


Alignment Length:276 Identity:62/276 - (22%)
Similarity:118/276 - (42%) Gaps:61/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PVGTTQVSKKIRNLDGDDSDDGSGTLPLVYQLPTAPRAN-RIFDDNSIPHKA------------- 78
            ||.::.||    ::.|.:|..|...:..|.::.|:...| .:|.....|.|:             
  Fly    15 PVSSSSVS----SVSGSESGQGLEDMLHVTKVRTSQVDNAELFMYGDGPKKSNSDLQKKVSTPDP 75

  Fly    79 --------PFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLI 135
                    ||:|.::|||.:..|.:|.:.|...::.||.:|:   :..|.:||.|||:::||||:
  Fly    76 EEEVSMEPPFVALVSNLPMECTEGELRKVFTSFSIRSLTIPK---KGKRPKGFAYVEMDSREDLV 137

  Fly   136 HVLSLPDPSIKGRRIRIELSNENDQQSRQKSNRRFDGFGNNGDNRDSGNWRRDSQNNGSNFGYSS 200
            .:|.:.....:||.:..::.....:...:.:...|..|..:|         |....|.|:  ||:
  Fly   138 RLLKMDKLKCRGRCLMAKIGQLPPEPPTKAAGDGFSLFTCSG---------RQFDINSSH--YSA 191

  Fly   201 NFERSFNRERKSLPDRDDVNTPGSWRTSARPQSIDTS------PTRR---EVEQVSEKYREGRVK 256
                       |:.|...:::|.|.|.|..|...::|      |.:|   ..|:|..:.:....|
  Fly   192 -----------SVSDLSTIDSPISARNSPFPSESESSFFGRDNPIKRIPSSTEEVERRMQIRLQK 245

  Fly   257 IADRYSREETSKVEEE 272
            :|: :...|:.:::.|
  Fly   246 LAE-FENSESERIKSE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 50/225 (22%)
RRM_eIF4B 79..155 CDD:240848 25/75 (33%)
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.