DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and Eif4h

DIOPT Version :9

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001006958.1 Gene:Eif4h / 288599 RGDID:1359222 Length:248 Species:Rattus norvegicus


Alignment Length:268 Identity:68/268 - (25%)
Similarity:119/268 - (44%) Gaps:66/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 IPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVL 138
            :|.:.|:.||:.||||:..:.|:...|:.:::.|:||.| |.:..:.:||.|||.:..:.|...|
  Rat    36 LPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVR-DKDTDKFKGFCYVEFDEVDSLKEAL 99

  Fly   139 SLPDPSIKGRRIRIELSNENDQQSRQKSNRRF-------DGFGNNGDNRDSGNWRRDSQNNGSNF 196
            :.....:..|.:|::::     :.|::....|       |..|..|.....|.|  ||:::.|: 
  Rat   100 TYDGALLGDRSLRVDIA-----EGRKQDKGGFGFRKGGPDDRGMGGSREPRGGW--DSRDDFSS- 156

  Fly   197 GYSSNFERSFNRERKSLPDRDDVNTPGSWRTSARPQSIDTSPTRREVEQVSEKYREG-RVKIADR 260
            ||                 |||..   ..|..:||..      ||....:..::|:| .::.::.
  Rat   157 GY-----------------RDDFL---GGRGGSRPGD------RRAGPPMGSRFRDGPPLRGSNM 195

  Fly   261 YSREETSKVEEERPKLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQGGTSSLNVFGSAKPVDTAA 325
            ..||.|.:...:||:|.|||||:..|                |::....:|. :||.|:|     
  Rat   196 DFREPTEEERAQRPRLQLKPRTVATP----------------LNQVANPNSA-IFGGARP----- 238

  Fly   326 RELEIEQR 333
            || |:.|:
  Rat   239 RE-EVVQK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 49/201 (24%)
RRM_eIF4B 79..155 CDD:240848 23/75 (31%)
Eif4hNP_001006958.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 1/4 (25%)
RRM_eIF4H 37..120 CDD:409835 24/88 (27%)
SF-CC1 <40..>227 CDD:273721 58/237 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..248 43/177 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.