DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and gar2

DIOPT Version :9

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_593531.1 Gene:gar2 / 2542869 PomBaseID:SPAC140.02 Length:500 Species:Schizosaccharomyces pombe


Alignment Length:181 Identity:54/181 - (29%)
Similarity:75/181 - (41%) Gaps:19/181 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GTTQVSKKIRNLDGDDSDDGSGTLPLVYQLPTAPRANRIFDDNSIPHKAPFIAYINNLPFDANED 94
            ||.::..::.||      |.|...|...|.....||....|..|.|....|   :.||.|:|.||
pombe   325 GTKEIDGRMVNL------DLSNPRPANPQPYAQQRAGNFGDQLSEPSDTVF---VGNLSFNATED 380

  Fly    95 DLYEFFEGI-NLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIKGRRIRIELSNEN 158
            ||...|.|. ::.|:||| .|.::||.:|||||...:.:.....:.:....|.||..|::.|...
pombe   381 DLSTAFGGCGDIQSIRLP-TDPQSGRLKGFGYVTFSDIDSAKKCVEMNGHFIAGRPCRLDFSTPR 444

  Fly   159 DQQSRQKSNRRF---DGFGNNGD-----NRDSGNWRRDSQNNGSNFGYSSN 201
            .....:.....|   .|||..|.     .|..|..|..:.|.||...:|.|
pombe   445 TGGGSRGGRGGFGGRGGFGGRGGFGGGRGRGRGGARSGNPNRGSVAPFSGN 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 43/139 (31%)
RRM_eIF4B 79..155 CDD:240848 27/76 (36%)
gar2NP_593531.1 RRM1_gar2 264..339 CDD:240893 5/19 (26%)
RRM2_gar2 368..439 CDD:240894 27/74 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.