DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and Eif4h

DIOPT Version :9

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_291039.1 Gene:Eif4h / 22384 MGIID:1341822 Length:248 Species:Mus musculus


Alignment Length:268 Identity:68/268 - (25%)
Similarity:118/268 - (44%) Gaps:66/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 IPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVL 138
            :|.:.|:.||:.||||:..:.|:...|:.:::.|:||.| |.:..:.:||.|||.:..:.|...|
Mouse    36 LPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVR-DKDTDKFKGFCYVEFDEVDSLKEAL 99

  Fly   139 SLPDPSIKGRRIRIELSNENDQQSRQKSNRRF-------DGFGNNGDNRDSGNWRRDSQNNGSNF 196
            :.....:..|.:|::::     :.|::....|       |..|..|.....|.|  ||::: .|.
Mouse   100 TYDGALLGDRSLRVDIA-----EGRKQDKGGFGFRKGGPDDRGMGGSRESRGGW--DSRDD-FNS 156

  Fly   197 GYSSNFERSFNRERKSLPDRDDVNTPGSWRTSARPQSIDTSPTRREVEQVSEKYREG-RVKIADR 260
            ||                 |||..   ..|..:||..      ||....:..::|:| .::.::.
Mouse   157 GY-----------------RDDFL---GGRGGSRPGD------RRAGPPMGSRFRDGPPLRGSNM 195

  Fly   261 YSREETSKVEEERPKLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQGGTSSLNVFGSAKPVDTAA 325
            ..||.|.:...:||:|.|||||:..|                |::....:|. :||.|:|     
Mouse   196 DFREPTEEERAQRPRLQLKPRTVATP----------------LNQVANPNSA-IFGGARP----- 238

  Fly   326 RELEIEQR 333
            || |:.|:
Mouse   239 RE-EVVQK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 49/201 (24%)
RRM_eIF4B 79..155 CDD:240848 23/75 (31%)
Eif4hNP_291039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 1/4 (25%)
RRM_eIF4H 37..120 CDD:409835 24/88 (27%)
SF-CC1 <40..>227 CDD:273721 58/237 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..248 43/176 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1292
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.