DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and cpf-2

DIOPT Version :10

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_499734.1 Gene:cpf-2 / 176742 WormBaseID:WBGene00000774 Length:336 Species:Caenorhabditis elegans


Alignment Length:123 Identity:29/123 - (23%)
Similarity:51/123 - (41%) Gaps:39/123 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YINNLPFDANEDDLYEFF-EGINLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIK 146
            ::.|:.:|.:||.:...| :..|::|:::. .|.|.|:.:|:|::|.              |.|:
 Worm    21 FVGNISYDVSEDTIRSIFSKAGNVLSIKMV-HDRETGKPKGYGFIEF--------------PDIQ 70

  Fly   147 GRRIRIELSNENDQQSRQKSNRRFDGFGNNGDNRDSGNWRRDSQNNGSN---FGYSSN 201
            ...:.|               |..:|:..:|     ...|.||...|.|   ||.|||
 Worm    71 TAEVAI---------------RNLNGYELSG-----RILRVDSAAGGMNMEEFGSSSN 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM_eIF4B 78..159 CDD:409836 16/76 (21%)
cpf-2NP_499734.1 RRM_CSTF2_RNA15_like 18..94 CDD:409832 21/107 (20%)
CSTF2_hinge 115..194 CDD:433869
CSTF_C 299..334 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.