DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and Hnrnpa1

DIOPT Version :10

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001034218.1 Gene:Hnrnpa1 / 15382 MGIID:104820 Length:373 Species:Mus musculus


Alignment Length:122 Identity:30/122 - (24%)
Similarity:51/122 - (41%) Gaps:3/122 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPSIKG 147
            ::..:..|..|..|.::||....|.:.....|..:|:.|||.:|..::.:.:..::.....::.|
Mouse   108 FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNG 172

  Fly   148 R--RIRIELSNENDQQSRQKSNRRFDGFGNNGDNRDSGNWRRDSQNNGSNFGYSSNF 202
            .  .:|..||.: :..|...|.|...|.||.|..|..|....|:...|.||.....|
Mouse   173 HNCEVRKALSKQ-EMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM_eIF4B 78..159 CDD:409836 16/77 (21%)
Hnrnpa1NP_001034218.1 RRM1_hnRNPA1 12..92 CDD:410154
RRM2_hnRNPA3 105..184 CDD:409996 16/75 (21%)
HnRNPA1 313..345 CDD:463312
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.