DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and HNRNPA0

DIOPT Version :10

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_006796.1 Gene:HNRNPA0 / 10949 HGNCID:5030 Length:305 Species:Homo sapiens


Alignment Length:137 Identity:33/137 - (24%)
Similarity:54/137 - (39%) Gaps:9/137 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DDNSIP--HKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENRE 132
            :|::.|  |......::..|..|..|.||.|.|.....:.......|.::|:.||||:|..:|.:
Human    86 EDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHD 150

  Fly   133 DLIHVLSLPDPSIKGRRIRIE--LSNENDQQSRQKSNRRFDGFGNNGDNRDSGNWRRDSQ--NNG 193
            .......:....|:|.|:.::  :..|:..........|....|..|..|..|   ||..  :.|
Human   151 AADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG---RDQNGLSKG 212

  Fly   194 SNFGYSS 200
            ...||:|
Human   213 GGGGYNS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM_eIF4B 78..159 CDD:409836 19/82 (23%)
HNRNPA0NP_006796.1 RRM1_hnRNPA0 5..83 CDD:409764
RRM2_hnRNPA0 99..178 CDD:409993 18/78 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..214 9/42 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.