DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4B and eif4h

DIOPT Version :9

Sequence 1:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001096677.1 Gene:eif4h / 100125209 XenbaseID:XB-GENE-970966 Length:252 Species:Xenopus tropicalis


Alignment Length:284 Identity:72/284 - (25%)
Similarity:113/284 - (39%) Gaps:78/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 IPHKAPFIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENREDLIHVL 138
            :|.:.||.||:.||||...:.|:...|:.:::.|:||.| |.|..:.:||.|||.::.:.|...|
 Frog    36 LPTEPPFTAYVGNLPFHVVQGDIDNIFKDLSIRSVRLVR-DKETDKFKGFCYVEFDDLDSLKEAL 99

  Fly   139 SLPDPSIKGRRIRIELSNENDQQSRQKSNRRFDGFGNNG-DNR--DSGNWRRDSQNNGSNFGY-S 199
            :........|.||::::     :.|::....| ||...| |.|  ||....|....:..|.|| .
 Frog   100 TYDGAIFIDRAIRVDIA-----EGRKQDKGGF-GFKKGGPDERGHDSSYGSRGGARDDFNSGYKD 158

  Fly   200 SNFERSFNRERKSLPDRDDVNT------PGSWRTSARPQSIDTSPTRREVEQVSEKYREGRVKIA 258
            .:|.....|..:|.|..|....      ||.:|.:.|..|.|                       
 Frog   159 DDFLGGRGRGGRSGPPGDRRGPPPAGGGPGRYRDAPRGGSAD----------------------- 200

  Fly   259 DRYSREETSKVEEERPKLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQGGTSSLNVFGSAKPVDT 323
               .||.|.:...:||:|.|||||:..|                |::.....|. :||.|||   
 Frog   201 ---FREPTDEERAQRPRLQLKPRTVATP----------------LNQVANPHSA-IFGGAKP--- 242

  Fly   324 AARELEIEQRLALARKQDKGRREQ 347
                           :::.|::|:
 Frog   243 ---------------REESGKKEK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 54/203 (27%)
RRM_eIF4B 79..155 CDD:240848 26/75 (35%)
eif4hNP_001096677.1 RRM_eIF4H 41..116 CDD:240847 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1292
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.