DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fj and CG8858

DIOPT Version :10

Sequence 1:NP_001015316.1 Gene:l(3)80Fj / 3355040 FlyBaseID:FBgn0287182 Length:2630 Species:Drosophila melanogaster
Sequence 2:NP_610746.1 Gene:CG8858 / 36319 FlyBaseID:FBgn0033698 Length:1890 Species:Drosophila melanogaster


Alignment Length:128 Identity:30/128 - (23%)
Similarity:51/128 - (39%) Gaps:21/128 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LRVGTMETISNEGDVDREQVLETFGIENE-------TGKETNGSRSF-DVGYS-SGDTLETLPKA 62
            |..|....:..||:...::.:||...|:|       |..:|....|. |.||. .|..|..|   
  Fly   176 LDAGKPNDLQQEGETLNKEPVETKPQESEPPEMQEVTAPQTPSKTSTNDAGYGWVGKLLSML--- 237

  Fly    63 SKVDISPADVLKTLFFILVWYTFSTFLTLYNKTLLGDDLGKFPAPLLMNTIHFSIQAVLSKMI 125
                :..|::|..:...::     |||..:.||.|....|:|..|.:.:.......|:.:|::
  Fly   238 ----LHLAELLLPITLQML-----TFLRNHTKTALLYLWGRFVQPFVADGSPARNDAMANKVV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FjNP_001015316.1 HEAT repeat 1142..1162 CDD:293787
HEAT repeat 1174..1204 CDD:293787
HEAT repeat 1214..1244 CDD:293787
HEAT repeat 1252..1283 CDD:293787
HEAT repeat 1297..1323 CDD:293787
HEAT repeat 1335..1364 CDD:293787
HEAT 1339..1483 CDD:441023
HEAT repeat 1375..1406 CDD:293787
HEAT repeat 1419..1443 CDD:293787
HEAT 1433..1642 CDD:441023
HEAT repeat 1456..1484 CDD:293787
HEAT repeat 1496..1526 CDD:293787
HEAT repeat 1534..1560 CDD:293787
HEAT repeat 1571..1600 CDD:293787
HEAT 1590..1800 CDD:441023
HEAT repeat 1616..1644 CDD:293787
HEAT repeat 1653..1684 CDD:293787
HEAT repeat 1692..1716 CDD:293787
HEAT repeat 1733..1758 CDD:293787
HEAT 1737..1910 CDD:441023
HEAT repeat 1881..1909 CDD:293787
HEAT 1900..2047 CDD:441023
HEAT repeat 1922..1950 CDD:293787
HEAT repeat 1963..1993 CDD:293787
HEAT repeat 2001..2027 CDD:293787
HEAT repeat 2033..2060 CDD:293787
HEAT repeat 2222..2251 CDD:293787
HEAT repeat 2260..2291 CDD:293787
HEAT repeat 2304..2333 CDD:293787
HEAT repeat 2342..2369 CDD:293787
HEAT repeat 2383..2412 CDD:293787
CG8858NP_610746.1 Ecm29 20..504 CDD:463769 30/128 (23%)
HEAT repeat 1164..1189 CDD:293787
HEAT repeat 1226..1259 CDD:293787
MMS19_C <1274..1332 CDD:463594
HEAT repeat 1275..1302 CDD:293787
HEAT repeat 1502..1535 CDD:293787
HEAT repeat 1545..1575 CDD:293787
HEAT repeat 1584..1613 CDD:293787
HEAT repeat 1624..1654 CDD:293787
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.