DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNASEK and rnaseka

DIOPT Version :9

Sequence 1:NP_001036433.1 Gene:RNASEK / 3355016 FlyBaseID:FBgn0262116 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001038870.1 Gene:rnaseka / 751692 ZFINID:ZDB-GENE-060825-301 Length:101 Species:Danio rerio


Alignment Length:89 Identity:44/89 - (49%)
Similarity:60/89 - (67%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPL-EEEYHSLEDFYAAANRAYNQNAYN 67
            |||||:.|||::|:||::.|.|:|:||..:|..||||:|| ||:.||.:....:..:.|||..||
Zfish     7 CGPKLAACGLVLSIWGVIMLALLGIFFTTHSAILIEDVPLTEEDLHSQDTPPQSVYKLYNQVGYN 71

  Fly    68 CWIAACIYVLTLLLSAQQFYMNSR 91
            |:|||.|||....||..|..:|.|
Zfish    72 CFIAAVIYVGIGFLSFCQVRLNKR 95



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7765
eggNOG 1 0.900 - - E1_2CYAA
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I5100
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1615928at2759
OrthoFinder 1 1.000 - - FOG0004618
OrthoInspector 1 1.000 - - otm25013
orthoMCL 1 0.900 - - OOG6_105122
Panther 1 1.100 - - LDO PTHR31733
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3452
SonicParanoid 1 1.000 - - X4328
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.