DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNASEK and Rnasek

DIOPT Version :9

Sequence 1:NP_001036433.1 Gene:RNASEK / 3355016 FlyBaseID:FBgn0262116 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_776103.1 Gene:Rnasek / 52898 MGIID:106369 Length:98 Species:Mus musculus


Alignment Length:91 Identity:38/91 - (41%)
Similarity:57/91 - (62%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSLEDFYAAANRAYN---QNA 65
            |||||:.||:::|.||::.|:::|:||.::|..||||:|..|     :||.......||   |.:
Mouse     7 CGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTE-----KDFENGPQNIYNLYEQVS 66

  Fly    66 YNCWIAACIYVLTLLLSAQQFYMNSR 91
            |||:|||.:|:|....|..|..:|.|
Mouse    67 YNCFIAAGLYLLLGGFSFCQVRLNKR 92



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8735
eggNOG 1 0.900 - - E1_2CYAA
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5222
Isobase 1 0.950 - 0 Normalized mean entropy S5051
OMA 1 1.010 - - QHG45229
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004618
OrthoInspector 1 1.000 - - oto95426
orthoMCL 1 0.900 - - OOG6_105122
Panther 1 1.100 - - LDO PTHR31733
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3452
SonicParanoid 1 1.000 - - X4328
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.810

Return to query results.
Submit another query.