powered by:
Protein Alignment RNASEK and CG11269
DIOPT Version :9
Sequence 1: | NP_001036433.1 |
Gene: | RNASEK / 3355016 |
FlyBaseID: | FBgn0262116 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611644.1 |
Gene: | CG11269 / 37527 |
FlyBaseID: | FBgn0034700 |
Length: | 107 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 30/73 - (41%) |
Similarity: | 43/73 - (58%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 CGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSLEDFYAAANRAYNQNAYNC 68
||.|..|..|.:|.||.:.|.|:|:|||:.|:.|:|.|||...:.|.|.|...|:.||...:..|
Fly 3 CGRKCCLFCLFMSAWGFLMLNLLGIFFYVQSLMLLESLPLPHHFPSQEAFKEQADEAYQDVSTRC 67
Fly 69 WIAACIYV 76
::||..|:
Fly 68 FVAAVFYL 75
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S5051 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1615928at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004618 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR31733 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3452 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
6 | 6.000 |
|
Return to query results.
Submit another query.