DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNASEK and CG11269

DIOPT Version :9

Sequence 1:NP_001036433.1 Gene:RNASEK / 3355016 FlyBaseID:FBgn0262116 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_611644.1 Gene:CG11269 / 37527 FlyBaseID:FBgn0034700 Length:107 Species:Drosophila melanogaster


Alignment Length:73 Identity:30/73 - (41%)
Similarity:43/73 - (58%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSLEDFYAAANRAYNQNAYNC 68
            ||.|..|..|.:|.||.:.|.|:|:|||:.|:.|:|.|||...:.|.|.|...|:.||...:..|
  Fly     3 CGRKCCLFCLFMSAWGFLMLNLLGIFFYVQSLMLLESLPLPHHFPSQEAFKEQADEAYQDVSTRC 67

  Fly    69 WIAACIYV 76
            ::||..|:
  Fly    68 FVAAVFYL 75



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5051
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1615928at2759
OrthoFinder 1 1.000 - - FOG0004618
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31733
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3452
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.