DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNASEK and SPOM_SPAC2F3.18C

DIOPT Version :10

Sequence 1:NP_001036433.1 Gene:RNASEK / 3355016 FlyBaseID:FBgn0262116 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001018267.3 Gene:SPOM_SPAC2F3.18C / 3361431 PomBaseID:SPAC2F3.18C Length:85 Species:Schizosaccharomyces pombe


Alignment Length:83 Identity:20/83 - (24%)
Similarity:31/83 - (37%) Gaps:13/83 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ICGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSLEDFYAAANRAYNQNAYN 67
            :..|.|:.....:|:.|||.|:::...|.|.:..|:.||             ..:.....|.|..
pombe     4 LVSPGLAKACTGLSLIGIVFLLVLSYLFSIEAETLMHDL-------------VGSGLTGKQVAKT 55

  Fly    68 CWIAACIYVLTLLLSAQQ 85
            |..|..||.:..|....|
pombe    56 CLGAVVIYAVFFLFCGSQ 73

Return to query results.
Submit another query.