DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNASEK and F49C12.12

DIOPT Version :9

Sequence 1:NP_001036433.1 Gene:RNASEK / 3355016 FlyBaseID:FBgn0262116 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_501635.1 Gene:F49C12.12 / 177755 WormBaseID:WBGene00009881 Length:95 Species:Caenorhabditis elegans


Alignment Length:96 Identity:39/96 - (40%)
Similarity:55/96 - (57%) Gaps:9/96 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KIC---GPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSLEDFYAAANRAYNQ 63
            |||   |||:|...:::||||::.|.|:|:||||.:|.|..||..|.  |.... .:..:..||:
 Worm     3 KICPLMGPKMSAFCMVMSVWGVIFLGLLGVFFYIQAVTLFPDLHFEG--HGKVP-SSVIDAKYNE 64

  Fly    64 NAYNCWIAACIYVLTLLLSAQQFYMNSRVTA 94
            .|..|||||.:|.:||:   ..|:.|...||
 Worm    65 KATQCWIAAGLYAVTLI---AVFWQNKYNTA 92



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6678
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I3959
Isobase 1 0.950 - 0 Normalized mean entropy S5051
OMA 1 1.010 - - QHG45229
OrthoDB 1 1.010 - - D1615928at2759
OrthoFinder 1 1.000 - - FOG0004618
OrthoInspector 1 1.000 - - oto17629
orthoMCL 1 0.900 - - OOG6_105122
Panther 1 1.100 - - LDO PTHR31733
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3452
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.960

Return to query results.
Submit another query.