DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk1 and S6K2

DIOPT Version :9

Sequence 1:NP_001036438.1 Gene:Gprk1 / 3355013 FlyBaseID:FBgn0260798 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001327294.1 Gene:S6K2 / 820019 AraportID:AT3G08720 Length:471 Species:Arabidopsis thaliana


Alignment Length:470 Identity:149/470 - (31%)
Similarity:242/470 - (51%) Gaps:69/470 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MEKSKCTPAAR------ASKKLNLPDPSVRSVMYKYLEKEGELNFHKIFNEVLGYLLFKDFCEND 75
            |..|:|:.|.:      ..|.|:|.....:||:...||.:        |::|.|     ...|.:
plant     1 MVSSQCSVANKNQTGKPFQKHLSLSISPPKSVLGDNLELQ--------FSDVFG-----PMPEAN 52

  Fly    76 SEEPIQQLKFFEQIKLFEKTECYDERKKMARDIYDNFIMEEMLSHTYEYSKHAVASVQKYLLKNE 140
            |||...              ..|||...:....:.......::||:.:.:|..       |.:.|
plant    53 SEEACD--------------VAYDEPAVVYSRSHSLVGPSLVVSHSLKMNKLT-------LRETE 96

  Fly   141 VPVDLFEPYLEEIFTQLKGKPFKKFLESDKFT----RFCQWKNLELNIQLTMNDFSVHRIIGRGG 201
            ..|||.|        .::|:..|   |:|:|:    ...:....|::..:.:.||.|.:::|:|.
plant    97 DSVDLVE--------CVEGESIK---ENDEFSGNDDTDSEKSPEEVSGVVGIEDFEVLKVVGQGA 150

  Fly   202 FGEVYGCRKADTGKMYAMKCLDKKRIKMKQGEMLALNERNMLQAVSTGIDCPFIVCMTYAFHTPD 266
            ||:||..||.||.::||||.:.|.:|..|........||::|    |.||.||||.:.|:|.|..
plant   151 FGKVYQVRKKDTSEIYAMKVMRKDKIVEKNHAEYMKAERDIL----TKIDHPFIVQLKYSFQTKY 211

  Fly   267 KLCFILDLMNGGDLHYHLSQHGIFSEDEMKFYAAEVILGLEHMHKRCIVYRDLKPANILLDENGH 331
            :|..:||.:|||.|.:.|...|:|.||..:.|.||::..:.|:|::.|::|||||.|||:|.:||
plant   212 RLYLVLDFINGGHLFFQLYHQGLFREDLARVYTAEIVSAVSHLHEKGIMHRDLKPENILMDVDGH 276

  Fly   332 IRISDLGLACDFSKK-KPHASVGTHGYMAPEVLSKGTSYDSCADWFSFGCMLYKLLKGHSPF--R 393
            :.::|.|||.:|.:. :.::..||..|||||:: :|..:|..|||:|.|.:||::|.|..||  .
plant   277 VMLTDFGLAKEFEENTRSNSMCGTTEYMAPEIV-RGKGHDKAADWWSVGILLYEMLTGKPPFLGS 340

  Fly   394 QHKTKDKLEIDKMTLTMNVELPESFSLELKNLLEMLLQRDVSKRLGCMGNGADEVKMHNFFCGID 458
            :.|.:.|:..||      ::||:..|.|...||:.|||::..:|||...:||:|:|.|.:|..|:
plant   341 KGKIQQKIVKDK------IKLPQFLSNEAHALLKGLLQKEPERRLGSGPSGAEEIKKHKWFKAIN 399

  Fly   459 WHQVYIQKYTPPLVP 473
            |.::..::..|...|
plant   400 WKKLEAREVQPSFKP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk1NP_001036438.1 RGS_GRK2_GRK3 30..186 CDD:188701 32/159 (20%)
PKc_like 185..531 CDD:304357 113/292 (39%)
Pkinase 191..454 CDD:278497 107/265 (40%)
PH_GRK2_subgroup 552..675 CDD:269946
PH 559..657 CDD:278594
S6K2NP_001327294.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.