DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gprk1 and grk6

DIOPT Version :9

Sequence 1:NP_001036438.1 Gene:Gprk1 / 3355013 FlyBaseID:FBgn0260798 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_689783.2 Gene:grk6 / 561288 ZFINID:ZDB-GENE-101006-5 Length:575 Species:Danio rerio


Alignment Length:544 Identity:203/544 - (37%)
Similarity:304/544 - (55%) Gaps:48/544 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DLEAVLADVSYLMAME--------KSKCTPAARASKKLNLPDPSVRSVMYKYLEKEGELNFHKIF 59
            :||.::|:...|.|.|        |||     :..:.|..|..|:...:.:.:||:        :
Zfish     2 ELENIVANTVLLKAREGGGGNRKGKSK-----KWKQMLQFPHISLCEELRQTIEKD--------Y 53

  Fly    60 NEV-----LGYLLFKDFCENDSEEPIQQ-LKFFEQIKLFEKTECYDE-RKKMARDIYDNFIMEEM 117
            |.:     :|.|||:.||  |:...::: ::|.:.:..:|.|.  || ||:..:::.|.::..:.
Zfish    54 NSLCERQPIGRLLFRQFC--DTRPELRRCVRFLDAVAEYEVTP--DEKRKECGQELLDKYLNTKS 114

  Fly   118 LSHTYEYSKHAVASVQKYLLKNEVPVDLFEPYLEEIFTQLKGKPFKKFLESDKFTRFCQWKNLEL 182
            ..:..|.::..|..... .|:.|...:||....:.|...|...||..:|:|..::||.|||.||.
Zfish   115 EDYIPEVTEEMVTKCAD-RLQQEACKELFMECTKLIHDYLSVAPFADYLDSMYYSRFLQWKWLER 178

  Fly   183 NIQLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGEMLALNERNMLQAVS 247
            . .:|.|.|..:|::|:||||||..|:...||||||.|.|:|||||.::||.:||||:.:|:.|:
Zfish   179 Q-PITKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGESMALNEKQILEKVN 242

  Fly   248 TGIDCPFIVCMTYAFHTPDKLCFILDLMNGGDLH---YHLSQHGIFSEDEMKFYAAEVILGLEHM 309
            :    .|:|.:.||:.|.|.||.:|.|||||||.   ||:.:.| |.|....|||||:..|||.:
Zfish   243 S----RFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGEAG-FDEKRAVFYAAEICCGLEDL 302

  Fly   310 HKRCIVYRDLKPANILLDENGHIRISDLGLACDFSKKKP-HASVGTHGYMAPEVLSKGTSYDSCA 373
            |:..||||||||.|||||::|||||||||||....:.:. ...|||.|||||||: |...|....
Zfish   303 HRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVV-KNERYTFSP 366

  Fly   374 DWFSFGCMLYKLLKGHSPFRQHKTKDKL-EIDKMTLTMNVELPESFSLELKNLLEMLLQRDVSKR 437
            ||::.||:||::::|.|||:|.|.|.|. |::::...:..|....||.:.|:|.:|||.:|.|:|
Zfish   367 DWWALGCLLYEMIEGQSPFQQRKKKIKREEVERLVKEVEEEYSSKFSEDAKSLCKMLLAKDPSER 431

  Fly   438 LGCMGNGADEVKMHNFFCGIDWHQVYIQKYTPPLVPPRGEVNAADAFDIGSFDEEDTKGIKLNDA 502
            |||.|.||.|||.|..|..|::.::.......|.:|....:...|..||..|  ...||::|...
Zfish   432 LGCQGGGASEVKAHLIFRSINFKRLAAGMLEAPFIPDPQAIYCKDVLDIEQF--STVKGVELEPK 494

  Fly   503 DQDLY-KMFSLTISERWQQEVSET 525
            |...| |:.:.::...||.|:.||
Zfish   495 DDSFYSKVSTGSVPIPWQNEMIET 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gprk1NP_001036438.1 RGS_GRK2_GRK3 30..186 CDD:188701 40/162 (25%)
PKc_like 185..531 CDD:304357 154/347 (44%)
Pkinase 191..454 CDD:278497 133/267 (50%)
PH_GRK2_subgroup 552..675 CDD:269946
PH 559..657 CDD:278594
grk6XP_689783.2 RGS_GRK6 35..179 CDD:188705 39/156 (25%)
STKc_GRK6 185..469 CDD:270779 137/289 (47%)
S_TKc 186..445 CDD:214567 132/264 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0986
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1104340at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.