DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17683 and ND-75

DIOPT Version :9

Sequence 1:NP_001036428.1 Gene:CG17683 / 3355011 FlyBaseID:FBgn0262115 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_511083.1 Gene:ND-75 / 31762 FlyBaseID:FBgn0017566 Length:731 Species:Drosophila melanogaster


Alignment Length:301 Identity:58/301 - (19%)
Similarity:106/301 - (35%) Gaps:90/301 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KVDIS------------LQDCLACSGC---------------ITSAEEVLITQQSREELLKVLQE 97
            |:|:|            ::|  .|||.               |..|:  |:.:.....:...:.|
  Fly   446 KIDLSYDHENLGADAALVKD--VCSGAHAFSKVLEGAKKPAIIIGAD--LLERADGAAIHATVAE 506

  Fly    98 NSKNKASEDWDNVRTIVFTLATQPILSLAYRYQIGVEDAARHLNGYFRSLGADYVLSTKVADDIA 162
            ..|.....:| |...::.|.|.| :.:|...|:.|.:.|.:........|.||   :.||..:..
  Fly   507 YCKKLKKPNW-NPFNVLQTNAAQ-VGALDVGYKAGAQTAVKAQPKVLFLLNAD---AGKVTREQL 566

  Fly   163 LLECRQEFVDRYRENENLTMLSSSCPGWVCYAEKTHGNFLLPYVSTTRSPQQ------------- 214
            ..:|...::..:.:| ..::..:..|| ..|.||..     .||:|...|||             
  Fly   567 PKDCFVVYIGSHGDN-GASIADAVLPG-AAYTEKQG-----IYVNTEGRPQQTLPGVSPPGMARE 624

  Fly   215 -------IMGVLVKQILADKMNVPASRIY----HVTVM---------------------PCYDKK 247
                   :..|:.|.:..|.::...:|:.    |:|.:                     ...|.|
  Fly   625 DWKILRALSEVVGKPLPYDNLDELRNRLEDVAPHLTRLGQLEPAGDAGAAGTISKSIGGGAIDIK 689

  Fly   248 LEASREDFFSKA--NNSRDVDCVITSVEVEQLLSEAQQPLS 286
            |:..|:.|.:.|  ..|..:...|::|..:|..:||:|.::
  Fly   690 LKELRDYFMTDAISRASPTMAKCISAVNKQQRENEAKQSVA 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17683NP_001036428.1 Nar1 29..464 CDD:226972 58/301 (19%)
Fe_hyd_lg_C 111..406 CDD:280978 44/223 (20%)
Fe_hyd_SSU 419..465 CDD:214899
ND-75NP_511083.1 Fer2_4 40..116 CDD:290244
PRK09130 42..722 CDD:236387 55/291 (19%)
NADH-G_4Fe-4S_3 123..163 CDD:214918
MopB_Res-Cmplx1_Nad11 263..636 CDD:239174 39/205 (19%)
NADH_dhqG_C 671..712 CDD:286416 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11615
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.