DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and AT5G38840

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_198700.2 Gene:AT5G38840 / 833875 AraportID:AT5G38840 Length:735 Species:Arabidopsis thaliana


Alignment Length:215 Identity:57/215 - (26%)
Similarity:97/215 - (45%) Gaps:28/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 PTERRPVRRSQSPRDRCHGGRDLDQRRQRN----QRHNNSNKNEDDHYVWGKEVDEKVPAENDVP 240
            |..|.|....:.|..........|:....|    :..|..:....:..|..:.::|.  .::.|.
plant     9 PPPRNPSHDIEPPEPNSTSISQSDETSTMNPPPPRNPNPPDLKTTEVVVEPEPIEES--KDDSVT 71

  Fly   241 VDKEKPNFGLSGALTEDTNKLNGVVVKYSEPPEARKPKRRWRLYPFKGETALPTLHIHRQSCFLV 305
            ||.:||       :...|.|.|  .|.|:.|..:..|..:::|...|....:..|.::::..:|.
plant    72 VDADKP-------VRPRTVKQN--PVPYTIPEWSGPPCHQFQLEVLKEGAIVEKLDVYKKGAYLF 127

  Fly   306 GRDRKVVDLAVDHPSCSKQHAALQYRLVPFEREDGSHGKRVRLYLIDLDSANGTFLNNKKIDARK 370
            ||| .:.|.|::|||.|:.||.:||      :..|:      .|:.||.|.:||.:|..|:|.:.
plant   128 GRD-GICDFALEHPSISRFHAVIQY------KRSGA------AYIFDLGSTHGTTVNKNKVDKKV 179

  Fly   371 YYELIEKDVIKFGFSSREYV 390
            :.:|...|||:||.|:|.|:
plant   180 FVDLNVGDVIRFGGSTRLYI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 36/111 (32%)
FHA <294..411 CDD:224630 34/97 (35%)
AT5G38840NP_198700.2 FHA 103..201 CDD:238017 36/110 (33%)
PTZ00108 <280..602 CDD:240271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.