DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and DDL

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_188691.1 Gene:DDL / 821601 AraportID:AT3G20550 Length:314 Species:Arabidopsis thaliana


Alignment Length:336 Identity:139/336 - (41%)
Similarity:193/336 - (57%) Gaps:39/336 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SSQSQEKRHKQLTHPSEDVHEQRSKWDSPERSNSHRNSTRQRRNTRSRSRERSERERDRDCERNK 141
            ||:|...|.|:|.....:....||:    ||.:..|.  |::||:         ||||||..|::
plant     4 SSRSPSPRTKRLRRARGEKEIGRSR----EREDDGRE--REKRNS---------RERDRDIGRDR 53

  Fly   142 ERDYNMQSSKERWQRSPALRHRSRSSERKNRERDRQRRPTERRPVR----RSQSPRDRCHGGRDL 202
            :|:...:..::|     .:..:.|.|.|::.|:.|:.|..:.|..|    ||.||.||.|.....
plant    54 DRERKGEGERDR-----EVGDKRRRSGREDTEKRRRTRTDDERYSRGRHERSTSPSDRSHRSSRR 113

  Fly   203 DQRRQRNQRHN-NSNKN--------EDDHYVWGKEVDEKVPAENDVPVDKEKPNFGLSGALTEDT 258
            ...|....||: .||..        |:|.....:.|:|.:.|:.     ||:|:|.|||.|.|:|
plant   114 SPERAIASRHDEGSNARGGSEEPNVEEDSVARMRAVEEALAAKK-----KEEPSFELSGKLAEET 173

  Fly   259 NKLNGVVVKYSEPPEARKPKRRWRLYPFK-GETALPTLHIHRQSCFLVGRDRKVVDLAVDHPSCS 322
            |:..|:.:.::||||||||..|||||.|| ||.....|.:|||||:|.||:|::.|:..||||||
plant   174 NRYRGITLLFNEPPEARKPSERWRLYVFKDGEPLNEPLCLHRQSCYLFGRERRIADIPTDHPSCS 238

  Fly   323 KQHAALQYRLVPFEREDGSHGKRVRLYLIDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSR 387
            ||||.:|||.:..|:.||..||:|:.|::||.|.|.|::|...|:.::||||.|||.||||.|||
plant   239 KQHAVIQYREMEKEKPDGMMGKQVKPYIMDLGSTNKTYINESPIEPQRYYELFEKDTIKFGNSSR 303

  Fly   388 EYVLLHENSKE 398
            |||||||||.|
plant   304 EYVLLHENSAE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 67/115 (58%)
FHA <294..411 CDD:224630 62/105 (59%)
DDLNP_188691.1 FHA 195..302 CDD:238017 58/106 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 113 1.000 Domainoid score I2048
eggNOG 1 0.900 - - E1_KOG1882
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134184
Inparanoid 1 1.050 232 1.000 Inparanoid score I1133
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 1 1.000 - - FOG0004489
OrthoInspector 1 1.000 - - oto3720
orthoMCL 1 0.900 - - OOG6_102703
Panther 1 1.100 - - LDO PTHR23308
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4267
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.