powered by:
Protein Alignment CG17168 and AT2G24410
DIOPT Version :9
Sequence 1: | NP_001015254.1 |
Gene: | CG17168 / 3354996 |
FlyBaseID: | FBgn0039943 |
Length: | 421 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_180017.1 |
Gene: | AT2G24410 / 816977 |
AraportID: | AT2G24410 |
Length: | 78 |
Species: | Arabidopsis thaliana |
Alignment Length: | 65 |
Identity: | 33/65 - (50%) |
Similarity: | 42/65 - (64%) |
Gaps: | 1/65 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 248 FGLSGALTEDTNKLNGVVVKYSEPPEARKPKRRWRLYPFK-GETALPTLHIHRQSCFLVGRDRKV 311
|.||..|.|:||...|:.:.::.|.:.||||.|||||.|| ||....||.||.|.|:|.||:||:
plant 10 FELSRKLAEETNIYKGITLLFNNPVDNRKPKERWRLYHFKDGEPLKETLCIHYQICYLFGRERKI 74
Fly 312 311
plant 75 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17168 | NP_001015254.1 |
FHA |
280..395 |
CDD:238017 |
20/33 (61%) |
FHA |
<294..411 |
CDD:224630 |
11/18 (61%) |
AT2G24410 | NP_180017.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1882 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D955935at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004489 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.820 |
|
Return to query results.
Submit another query.