DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and AT2G24410

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_180017.1 Gene:AT2G24410 / 816977 AraportID:AT2G24410 Length:78 Species:Arabidopsis thaliana


Alignment Length:65 Identity:33/65 - (50%)
Similarity:42/65 - (64%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 FGLSGALTEDTNKLNGVVVKYSEPPEARKPKRRWRLYPFK-GETALPTLHIHRQSCFLVGRDRKV 311
            |.||..|.|:||...|:.:.::.|.:.||||.|||||.|| ||....||.||.|.|:|.||:||:
plant    10 FELSRKLAEETNIYKGITLLFNNPVDNRKPKERWRLYHFKDGEPLKETLCIHYQICYLFGRERKI 74

  Fly   312  311
            plant    75  74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 20/33 (61%)
FHA <294..411 CDD:224630 11/18 (61%)
AT2G24410NP_180017.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 1 1.000 - - FOG0004489
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.