DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and SNIP1

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_078976.2 Gene:SNIP1 / 79753 HGNCID:30587 Length:396 Species:Homo sapiens


Alignment Length:433 Identity:170/433 - (39%)
Similarity:232/433 - (53%) Gaps:77/433 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQRNKEHELEQQRTGHEGDTKMSDRNLSKTKKIK--------QRATADSSSSSDSSNESKKSNH- 58
            |....|.|...:|...:||..:....:.|.:::.        :|......|.|..::|..:|.| 
Human     2 KAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARSGHR 66

  Fly    59 -------SSLSPNRKQRTAGKRQRDSSQSQEKRHKQLTHPSEDVHEQRSKWDSPERSNSHRNSTR 116
                   |...|.:|.:.:|:|   |...:.||::...|.:..|.::|.  |.|.|....|    
Human    67 GNRARGVSRSPPKKKNKASGRR---SKSPRSKRNRSPHHSTVKVKQERE--DHPRRGREDR---- 122

  Fly   117 QRRNTRSRSRERSERERDRDCERNKERDYNMQSSKERWQRSPALRHRSRSSERKNRERDRQRRPT 181
                   :.||.||:|..|  .||.:||                |||..|         .|||.:
Human   123 -------QHREPSEQEHRR--ARNSDRD----------------RHRGHS---------HQRRTS 153

  Fly   182 ERRPVRRSQSPRDRCHGGRDLDQRRQRNQRHN---NSNKNEDDHYVWGKEVDEKVP------AEN 237
            ..||.......|||  ..::|..:.:..:.:|   ..::..:|....|.|..|.||      .|.
Human   154 NERPGSGQGQGRDR--DTQNLQAQEEEREFYNARRREHRQRNDVGGGGSESQELVPRPGGNNKEK 216

  Fly   238 DVPVDKEKPNFGLSGALTEDTNKLNGVVVKYSEPPEARKPKRRWRLYPFKGETALPTLHIHRQSC 302
            :||. ||||:|.|||||.||||...|||:|||||||||.||:||||||||.:..||.::|||||.
Human   217 EVPA-KEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSA 280

  Fly   303 FLVGRDRKVVDLAVDHPSCSKQHAALQYRLVPFEREDGSHGKRVRLYLIDLDSANGTFLNNKKID 367
            :|:||.|::.|:.:||||||||||..|||||.:.|.||:.|:||:.|:|||.|.||||||||:|:
Human   281 YLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIE 345

  Fly   368 ARKYYELIEKDVIKFGFSSREYVLLHENS------KEDQEDDD 404
            .::||||.||||:||||||||||||||:|      ::|.||::
Human   346 PQRYYELKEKDVLKFGFSSREYVLLHESSDTSEIDRKDDEDEE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 76/114 (67%)
FHA <294..411 CDD:224630 71/117 (61%)
SNIP1NP_078976.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..227 65/270 (24%)
PRK12678 24..>208 CDD:237171 51/228 (22%)
FHA 258..361 CDD:238017 64/102 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..396 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147906
Domainoid 1 1.000 129 1.000 Domainoid score I5301
eggNOG 1 0.900 - - E1_KOG1882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 268 1.000 Inparanoid score I3033
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52032
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 1 1.000 - - FOG0004489
OrthoInspector 1 1.000 - - oto90534
orthoMCL 1 0.900 - - OOG6_102703
Panther 1 1.100 - - LDO PTHR23308
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2234
SonicParanoid 1 1.000 - - X4267
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.