DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and ppp1r8a

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001094422.1 Gene:ppp1r8a / 566830 ZFINID:ZDB-GENE-060503-681 Length:351 Species:Danio rerio


Alignment Length:160 Identity:50/160 - (31%)
Similarity:72/160 - (45%) Gaps:22/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 PPEARKPKRRWRLYPFKGETALPTLHIHRQSCFLVGRDRKVVDLAVDHPSCSKQHAALQYRLVPF 335
            |..|.||.....|...||:..:..|.|..:..:|.||:....|..:||.|||:.||||.|.    
Zfish    15 PSWAGKPPPGLHLDVVKGDKLIEKLIIDEKKFYLFGRNPDHCDFTIDHQSCSRVHAALVYH---- 75

  Fly   336 EREDGSHGKRVRLYLIDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSREYVLLH--ENSKE 398
                 .|.|||  :||||:|.:||||...:::..|..::.....:.||.|:|.|.|..  :....
Zfish    76 -----RHLKRV--FLIDLNSTHGTFLGRIRLEPHKPQQVPIDSTMSFGASTRVYTLREKPQTQSS 133

  Fly   399 DQEDDDVHIKDE--------PHDAPTEVAN 420
            ....|...::||        |.: .||:.|
Zfish   134 STTGDSKGVEDEELKGLLGLPEE-ETELEN 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 39/116 (34%)
FHA <294..411 CDD:224630 39/126 (31%)
ppp1r8aNP_001094422.1 FHA 25..124 CDD:238017 38/109 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.