DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and cep170ab

DIOPT Version :10

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_068074381.1 Gene:cep170ab / 566358 ZFINID:ZDB-GENE-050309-106 Length:1351 Species:Danio rerio


Alignment Length:115 Identity:32/115 - (27%)
Similarity:55/115 - (47%) Gaps:24/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 HR--QSCFLVGRDRKVVDLAVDHPSCSKQHAALQYRLVPFEREDGSHGKRVRLYLIDLDSANGTF 360
            ||  :....||||.  .:|.:...|..||||.:.|       |:.:...:|:    ||.|.||||
Zfish    16 HRLPREMIFVGRDD--CELMLQSRSVDKQHAVINY-------EEATDEHKVK----DLGSLNGTF 67

  Fly   361 LNNKKIDARKYYELIEKDVIKFGFSSREYVLLHENSKEDQEDDDVHIKDE 410
            :|:.:|..::|..|...|.::||:.:..:.:|.         .::|:.:|
Zfish    68 VNDVRILEQQYITLKMGDKLRFGYDTNLFTVLR---------GELHVPEE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 SF-CC1 138..>246 CDD:273721
FHA_SNIP1 246..394 CDD:438770 30/97 (31%)
cep170abXP_068074381.1 FHA_Cep170A 1..106 CDD:438776 31/111 (28%)
CEP170_C 685..1290 CDD:464633
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.