DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and slc4a1ap

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_690835.5 Gene:slc4a1ap / 562351 ZFINID:ZDB-GENE-080521-2 Length:768 Species:Danio rerio


Alignment Length:327 Identity:72/327 - (22%)
Similarity:128/327 - (39%) Gaps:74/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SSQSQEKRHKQLTHPSEDVHEQRSKWDSPERSNSHRNSTRQRRNTRSRSRERSERERDRDCERNK 141
            :.:||:..:.::....:|:.......|.|.:......|...:::. ..|::.:| |.......|.
Zfish    19 TEKSQDPENGKICDSKQDITSTNETADDPFKKPVLTPSLAVKKSL-GPSKKPTE-EVSSSVSENT 81

  Fly   142 ERDYNMQSSKERWQRSPALRHRSRSSERKNRERDRQRRPTERRPVRRSQSPRDRCHGGRDLDQRR 206
            :.|::             .:|...:::.|:.:.|    |::..|..|.:.||.:..         
Zfish    82 DADHD-------------TKHLLSTAKAKDTKID----PSDHPPSERLKEPRVQPK--------- 120

  Fly   207 QRNQRHNNSNKNEDDHYVWGKEVDEKVPAENDVPVDKEKPNFGLSGALTEDTNKLNGVVVKYSEP 271
                               .|::..|:|     |..|..|                   :.|:||
Zfish   121 -------------------SKDIRPKIP-----PAGKFPP-------------------LPYTEP 142

  Fly   272 PEARKPKRRWRLYPFKGETALPTLHIHRQSCFLVGRDRKVVDLAVDHPSCSKQHAALQYRLVPFE 336
            |....|...:.....|....|.|:.:..:|.|:||| ..|.|::::|||.|:.||.:|||  ...
Zfish   143 PWGAVPDINYSFELLKNGAILDTVPLTHRSYFVVGR-LPVCDVSLEHPSISRYHAVVQYR--GRA 204

  Fly   337 REDGSHGKRVRLYLIDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSREYVLLHENSKEDQE 401
            .::|..|:....|..||.|.:|||:|..||..:.|..|....|:|||.|:|.::|......|:.|
Zfish   205 GQEGVVGEERGFYAYDLGSTHGTFINKNKIPPKTYIRLRVGHVLKFGGSTRLFILQGPEFDEEAE 269

  Fly   402 DD 403
            .:
Zfish   270 SE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 40/114 (35%)
FHA <294..411 CDD:224630 40/110 (36%)
slc4a1apXP_690835.5 FHA 106..276 CDD:224630 57/221 (26%)
FHA 155..260 CDD:238017 39/107 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.