DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and PPP1R8

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_054829.2 Gene:PPP1R8 / 5511 HGNCID:9296 Length:351 Species:Homo sapiens


Alignment Length:145 Identity:47/145 - (32%)
Similarity:70/145 - (48%) Gaps:21/145 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 PPEARKPKRRWRLYPFKGETALPTLHIHRQSCFLVGRDRKVVDLAVDHPSCSKQHAALQYRLVPF 335
            |..|.||.....|...||:..:..|.|..:..:|.||:..:.|..:||.|||:.||||.|.    
Human    17 PTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYH---- 77

  Fly   336 EREDGSHGKRVRLYLIDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSREYVLLHE------ 394
                 .|.|||  :||||:|.:||||.:.:::..|..::.....:.||.|:|.|.|..:      
Human    78 -----KHLKRV--FLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPS 135

  Fly   395 ----NSKEDQEDDDV 405
                :.|...|||::
Human   136 AVKGDEKMGGEDDEL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 39/124 (31%)
FHA <294..411 CDD:224630 40/122 (33%)
PPP1R8NP_054829.2 Interaction with CDC5L, SF3B1 and MELK. /evidence=ECO:0000269|PubMed:10827081, ECO:0000269|PubMed:12105215, ECO:0000269|PubMed:14699119 1..142 43/135 (32%)
FHA 27..119 CDD:238017 34/102 (33%)
WASH_WAHD <98..>212 CDD:403229 11/53 (21%)
Interaction with EED. /evidence=ECO:0000269|PubMed:12788942 143..224 3/8 (38%)
Nuclear localization signal 1. /evidence=ECO:0000269|PubMed:11034904 185..209
Involved in PP-1 inhibition 191..200
Involved in PP-1 binding 200..203
Nuclear localization signal 2. /evidence=ECO:0000269|PubMed:11034904 210..240
Interaction with EED. /evidence=ECO:0000269|PubMed:12788942 310..329
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..351
RNA-binding 330..351
Involved in PP-1 inhibition 331..337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.