DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and ppp1r8

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001017079.1 Gene:ppp1r8 / 549833 XenbaseID:XB-GENE-479608 Length:346 Species:Xenopus tropicalis


Alignment Length:144 Identity:49/144 - (34%)
Similarity:72/144 - (50%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 PPEARKPKRRWRLYPFKGETALPTLHIHRQSCFLVGRDRKVVDLAVDHPSCSKQHAALQYRLVPF 335
            |..|.||.:...|...||:..:..|.|..:..:|.||:..:.|..:||.|||:.|:||.|.    
 Frog    15 PSWAGKPPQGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDICDFTIDHQSCSRVHSALVYH---- 75

  Fly   336 EREDGSHGKRVRLYLIDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSREYVL------LHE 394
                 .|.|||  :||||:|.:||||.:.:::..|..::.....|.||.|:|.|.|      |..
 Frog    76 -----KHLKRV--FLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTISFGASTRMYTLREKPQTLPS 133

  Fly   395 NSKEDQ---EDDDV 405
            ..|.|:   |||::
 Frog   134 ALKGDEKAGEDDEL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 40/120 (33%)
FHA <294..411 CDD:224630 42/121 (35%)
ppp1r8NP_001017079.1 FHA 25..117 CDD:238017 34/102 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.