DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and CG7706

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650742.2 Gene:CG7706 / 42244 FlyBaseID:FBgn0038640 Length:726 Species:Drosophila melanogaster


Alignment Length:209 Identity:50/209 - (23%)
Similarity:87/209 - (41%) Gaps:51/209 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 KVPA-------------ENDVPVDKEKPNFGLSGALTEDTNKLNGVVV------KYSEPPEARKP 277
            ||||             .::||.:...|...:     ..|.|.:...|      |:|.||...  
  Fly     5 KVPAPLPKPKVIITEKPRSEVPAEPPPPPLKI-----PKTPKSSPAAVCPYKVPKWSAPPAEN-- 62

  Fly   278 KRRWRLYPF---KGETALPTLH-IHRQSCFLVGRDRKVVDLAVDHPSCSKQHAALQYR------- 331
                ::|.|   |....:.|:| :.:|:.:..|| ....|:...||:.|:.|..|||:       
  Fly    63 ----QIYSFEVLKSGQIIDTVHQLQQQAVWTFGR-LPENDVPAAHPTISRFHVVLQYKPKAPPKP 122

  Fly   332 -------LVPFEREDGSHGKRVRLYLIDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSREY 389
                   .:..|.|:..:.:....|:.|:.|.:|||||.:::..:.|..:....::|.|.|:|.|
  Fly   123 ETAKEDDEMEEEDEEPKNDQPEGWYIYDMGSTHGTFLNKQRVPPKVYIRMRVGHMLKLGGSTRVY 187

  Fly   390 VLLHENSKEDQEDD 403
            :|  :...||:|.:
  Fly   188 IL--QGPGEDEEPE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 33/132 (25%)
FHA <294..411 CDD:224630 33/125 (26%)
CG7706NP_650742.2 FHA 69..190 CDD:238017 31/123 (25%)
FHA <84..215 CDD:224630 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23308
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.