DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and CG7706

DIOPT Version :10

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650742.2 Gene:CG7706 / 42244 FlyBaseID:FBgn0038640 Length:726 Species:Drosophila melanogaster


Alignment Length:43 Identity:12/43 - (27%)
Similarity:19/43 - (44%) Gaps:10/43 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SPADRSYSGVSGGQGQELTIQEFETVTEKIRRHGTYGQSKPPY 175
            ||:||.|| ..|.:|         .:..:..|:|..|:.:..|
  Fly   336 SPSDRDYS-PKGRRG---------PIRSRHNRYGGRGRRRDSY 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 SF-CC1 138..>246 CDD:273721 8/38 (21%)
FHA_SNIP1 246..394 CDD:438770
CG7706NP_650742.2 FHA_Kanadaptin 65..191 CDD:438729
DSRM_Kanadaptin 263..345 CDD:380685 6/9 (67%)
PTZ00108 <316..699 CDD:240271 12/43 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.