DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and Slc4a1ap

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_038967837.1 Gene:Slc4a1ap / 298805 RGDID:1307080 Length:738 Species:Rattus norvegicus


Alignment Length:205 Identity:64/205 - (31%)
Similarity:86/205 - (41%) Gaps:39/205 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 VDEKVPAEN-DVPVD--KEKPNFGLSGALTE--------DTNKLNGVVVK--------------- 267
            |..|.||.: .||.|  ||.....|.....|        |:.:..|..|:               
  Rat    31 VRSKAPASSPSVPEDVKKECSTAQLDSGCGEPEVSPPQPDSEETGGPPVEQLRSPRVAPASGGPT 95

  Fly   268 ----YSEPPEARKPKRRWRLYPFKGETALPTLHIHRQSCFLVGRDRKVVDLAVDHPSCSKQHAAL 328
                |.||.........:.|...||.|.|.|..:...|..|.|| ....|:.::|||.|:.||.|
  Rat    96 RAPPYQEPSWGSPATAPYSLETLKGGTILGTRTLKDTSYCLFGR-LASCDICLEHPSVSRYHAVL 159

  Fly   329 QYR-LVPF-EREDGSHGKRVRLYLIDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSREYVL 391
            |:| ..|. :.||...|    .||.||.|.:|||||..:|..|.|..:....||:||.|:|.::|
  Rat   160 QHRGSDPSGDSEDQGQG----FYLYDLGSTHGTFLNKTRIPPRTYCRVHVGHVIRFGGSTRLFIL 220

  Fly   392 LHENSKEDQE 401
              :..:||:|
  Rat   221 --QGPEEDRE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 44/116 (38%)
FHA <294..411 CDD:224630 42/110 (38%)
Slc4a1apXP_038967837.1 minC <12..>121 CDD:178806 19/89 (21%)
FHA 113..221 CDD:238017 44/114 (39%)
DSRM_Kanadaptin 309..391 CDD:380685
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.