Sequence 1: | NP_001015254.1 | Gene: | CG17168 / 3354996 | FlyBaseID: | FBgn0039943 | Length: | 421 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038967837.1 | Gene: | Slc4a1ap / 298805 | RGDID: | 1307080 | Length: | 738 | Species: | Rattus norvegicus |
Alignment Length: | 205 | Identity: | 64/205 - (31%) |
---|---|---|---|
Similarity: | 86/205 - (41%) | Gaps: | 39/205 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 229 VDEKVPAEN-DVPVD--KEKPNFGLSGALTE--------DTNKLNGVVVK--------------- 267
Fly 268 ----YSEPPEARKPKRRWRLYPFKGETALPTLHIHRQSCFLVGRDRKVVDLAVDHPSCSKQHAAL 328
Fly 329 QYR-LVPF-EREDGSHGKRVRLYLIDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSREYVL 391
Fly 392 LHENSKEDQE 401 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17168 | NP_001015254.1 | FHA | 280..395 | CDD:238017 | 44/116 (38%) |
FHA | <294..411 | CDD:224630 | 42/110 (38%) | ||
Slc4a1ap | XP_038967837.1 | minC | <12..>121 | CDD:178806 | 19/89 (21%) |
FHA | 113..221 | CDD:238017 | 44/114 (39%) | ||
DSRM_Kanadaptin | 309..391 | CDD:380685 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D955935at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |