DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and Slc4a1ap

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001334257.1 Gene:Slc4a1ap / 20534 MGIID:1196608 Length:744 Species:Mus musculus


Alignment Length:134 Identity:47/134 - (35%)
Similarity:66/134 - (49%) Gaps:5/134 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 YSEPPEARKPKRRWRLYPFKGETALPTLHIHRQSCFLVGRDRKVVDLAVDHPSCSKQHAALQYRL 332
            |.||.........:.|...||.|.|.|..:...||...|| ....|:.::|||.|:.||.||:| 
Mouse   100 YREPSWGSPATAPYSLETLKGGTILGTRTLKDTSCCFFGR-LASCDICLEHPSVSRYHAVLQHR- 162

  Fly   333 VPFEREDGSHGKRVRLYLIDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSREYVLLHENSK 397
             ..:....|.|.....||.||.|.:|||||..:|..|.|..:....|::||.|:|.::|  :..:
Mouse   163 -GADPSGDSEGHEQGFYLYDLGSTHGTFLNKTRIPPRTYCRVHVGHVMRFGGSTRLFIL--QGPE 224

  Fly   398 EDQE 401
            ||:|
Mouse   225 EDRE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 41/114 (36%)
FHA <294..411 CDD:224630 39/108 (36%)
Slc4a1apNP_001334257.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.