Sequence 1: | NP_001015254.1 | Gene: | CG17168 / 3354996 | FlyBaseID: | FBgn0039943 | Length: | 421 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_499172.1 | Gene: | ZK632.2 / 176386 | WormBaseID: | WBGene00014011 | Length: | 710 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 53/198 - (26%) |
---|---|---|---|
Similarity: | 88/198 - (44%) | Gaps: | 25/198 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 EKV--PAEN-DVPVDKEKPNFGLSGALTEDTNKLN--GVVVKYSEPPEARKP----KRRWRLYPF 286
Fly 287 KGETALPTLHIHRQSCFLV-GRDRKVVDLAVDHPSCSKQHAALQYRLVPFEREDGSHGKRVRLYL 350
Fly 351 IDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSREYVLLHENSKEDQEDDDVHIKDEPHDAP 415
Fly 416 TEV 418 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17168 | NP_001015254.1 | FHA | 280..395 | CDD:238017 | 30/115 (26%) |
FHA | <294..411 | CDD:224630 | 32/117 (27%) | ||
ZK632.2 | NP_499172.1 | FHA | 86..183 | CDD:238017 | 26/102 (25%) |
FHA | <110..224 | CDD:224630 | 32/114 (28%) | ||
dsrm | 276..348 | CDD:278464 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D955935at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |