DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17168 and ZK632.2

DIOPT Version :9

Sequence 1:NP_001015254.1 Gene:CG17168 / 3354996 FlyBaseID:FBgn0039943 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_499172.1 Gene:ZK632.2 / 176386 WormBaseID:WBGene00014011 Length:710 Species:Caenorhabditis elegans


Alignment Length:198 Identity:53/198 - (26%)
Similarity:88/198 - (44%) Gaps:25/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 EKV--PAEN-DVPVDKEKPNFGLSGALTEDTNKLN--GVVVKYSEPPEARKP----KRRWRLYPF 286
            ||:  |||. |.||:........:....|..:|::  ...:.|..||.|.:|    |.::.:...
 Worm    26 EKIRAPAEQMDGPVEGVIDEIETAEVQAEKESKISVQAPALHYEVPPWACEPDPAHKFQFEILKE 90

  Fly   287 KGETALPTLHIHRQSCFLV-GRDRKVVDLAVDHPSCSKQHAALQYRLVPFEREDGSHGKRVRLYL 350
            ....|...|...:.|.|:| ||.:...||.::|||.|:.|..|||.    ..:....||  ..::
 Worm    91 GKLIASYDLSNRKNSTFVVIGRIKPGCDLLMEHPSISRYHCILQYG----NDKMSKTGK--GWHI 149

  Fly   351 IDLDSANGTFLNNKKIDARKYYELIEKDVIKFGFSSREYVLLHENSKEDQEDDDVHIKDEPHDAP 415
            .:|.|.:|:.:|.|::..::|.......:.:||.|:|  :|.....:||.|       .|...:|
 Worm   150 FELGSTHGSRMNKKRLPPKQYIRTRVGFIFQFGESTR--ILNFVGPEEDSE-------PEWDCSP 205

  Fly   416 TEV 418
            ||:
 Worm   206 TEM 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17168NP_001015254.1 FHA 280..395 CDD:238017 30/115 (26%)
FHA <294..411 CDD:224630 32/117 (27%)
ZK632.2NP_499172.1 FHA 86..183 CDD:238017 26/102 (25%)
FHA <110..224 CDD:224630 32/114 (28%)
dsrm 276..348 CDD:278464
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D955935at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.