DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17167 and SLC8A2

DIOPT Version :9

Sequence 1:NP_001015257.2 Gene:CG17167 / 3354991 FlyBaseID:FBgn0039941 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_055878.1 Gene:SLC8A2 / 6543 HGNCID:11069 Length:921 Species:Homo sapiens


Alignment Length:220 Identity:46/220 - (20%)
Similarity:86/220 - (39%) Gaps:65/220 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 FWWIFVFPIKVTLSLLIPHPMKYRRLYPLSFIMCILCIG----GNAYLIVWMLTA--------FG 383
            ||.:        |...:| |.:|             |.|    |.:.|::.:|||        ||
Human   732 FWKV--------LFACVP-PTEY-------------CHGWACFGVSILVIGLLTALIGDLASHFG 774

  Fly   384 VAIHVPTIVMGLTFLAAGSTMPEAVSSLI-SLRNGENGIGVSNSLGANSLAILLSLGVPWFIKNC 447
            ..:.:...|..:.|:|.|:::|:..:|.: :|::......:.|..|:|::.:.|.|||.|.:...
Human   775 CTVGLKDSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAV 839

  Fly   448 IHYGTGEPQQVGTQGIEYNILILIISTMALFIILSFSG-----YRLTKRVG-------------- 493
            .....|.|.:|.|..:.:::        .||.:.:|.|     ||....:|              
Human   840 YWAVQGRPFEVRTGTLAFSV--------TLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATT 896

  Fly   494 ---VALFTVYGVFIVLQILIEMNVF 515
               :.|:.:|.:|..|:....:..|
Human   897 ALFLGLWLLYILFASLEAYCHIRGF 921

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17167NP_001015257.2 TIGR00367 85..503 CDD:273039 43/206 (21%)
Na_Ca_ex 86..229 CDD:279963
Na_Ca_ex 356..509 CDD:279963 39/187 (21%)
SLC8A2NP_055878.1 caca 1..921 CDD:273296 45/218 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..42
Alpha-1 135..175
Putative calmodulin-binding region. /evidence=ECO:0000250|UniProtKB:P23685 248..267
Alpha-2 790..826 8/35 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4242
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.