DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17167 and CG34162

DIOPT Version :9

Sequence 1:NP_001015257.2 Gene:CG17167 / 3354991 FlyBaseID:FBgn0039941 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001097149.2 Gene:CG34162 / 5740392 FlyBaseID:FBgn0085191 Length:535 Species:Drosophila melanogaster


Alignment Length:503 Identity:86/503 - (17%)
Similarity:175/503 - (34%) Gaps:125/503 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LHVFAAVYFFIL------LAIICNDYFLPTVECICEDLHLSKDVAAATFMATATSM--PEFFTNT 141
            :.::..:..|:|      |.::...:|:|.:..:.|       .|..|...::..:  |.||.:.
  Fly    57 MSIYGLISAFLLMVHLSVLFMVTKYFFVPNLATLIE-------FAPMTMFGSSFLLFGPTFFVSY 114

  Fly   142 ISTL-----------ILESDMGLGTIIGSLM-FNTLGVAGLAA--LAIDKPVQLDWWPIARDCFI 192
            .::.           |..|.:....|:|.:: :..:|...:.|  ..:|   .:.:|    .|..
  Fly   115 YNSFWEICNPRKPESICLSPLQFAKIMGDILRYIVIGFMVICAQGYRVD---GITFW----SCLS 172

  Fly   193 YVFNTIILLVLAWSGSIS---FTESCIMMGFLILYYLITFNNNKFMPAIRVFIEDRMNCCFS-TR 253
            ::...::.|.:....|.:   .......:.|.:..:|.||    .|..:.:|:....|  |. ::
  Fly   173 FILTGMVYLYIVIKKSYNVYLIVADLYSIKFRVTVFLYTF----LMVLLVIFVVSYAN--FQRSK 231

  Fly   254 YDLTEPPENSAKAQLPLKKDPLSGDGLFVLNLPENTSSMSSTANLTRNKHLNDEDDVAD------ 312
            ....:..||.      |:.|  |||.:    |.:....|..:......|.:|...::||      
  Fly   232 VKSKQTQENF------LEMD--SGDEI----LGKYQKQMEFSRREIWLKAVNGYRNMADSNVIYR 284

  Fly   313 --VVPG--------SIYAYPRDASGWMQF---WWIFVFPIKVTLSLLIPHPMK-------YRRLY 357
              ::|.        .:.:..|...||.::   ..:|..||     :.:||..|       :...:
  Fly   285 IAMIPSYFVLANFIPVISNDRALIGWNKYTSCLGLFFLPI-----ICLPHGFKAVSWLIMFLTCW 344

  Fly   358 PLSFIMCILCIGGNAYLIVWMLTAFGVAI------------------------HVPTIVMGLTFL 398
            .||.:..|..........:|:....|:.:                        .|...|..|.:.
  Fly   345 TLSILTFISTHSLRRPNNIWIFALLGLIVSSVFINLLSREIENIIYQYISMQFDVMPDVTALVYF 409

  Fly   399 AAGSTMPEA--VSSLISLRNGENGIGVSNSLGANSLAILLSLGVPWFIKNCIHYGTGEPQQVGTQ 461
            ..|..:.|:  |..|...:..:...||..||...::.:...|   .|.:.|.:   .:...:.|.
  Fly   410 GLGEMLSESIVVRCLQQRKMWDATFGVVMSLVTYAIFLAFPL---LFFQGCYN---NKCSIMVTS 468

  Fly   462 GIEYNI--LILIISTMALFIILSFSGYRLTKRVGVALFTVYGVFIVLQ 507
            ..|..|  :.|::||..|.:.||...:|::....:.:.||:  ::.||
  Fly   469 STETTIHFIFLVLSTCLLHVSLSGYEFRISLLFYLLVLTVF--YVTLQ 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17167NP_001015257.2 TIGR00367 85..503 CDD:273039 84/497 (17%)
Na_Ca_ex 86..229 CDD:279963 24/167 (14%)
Na_Ca_ex 356..509 CDD:279963 33/180 (18%)
CG34162NP_001097149.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.