DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17167 and slc8b1

DIOPT Version :9

Sequence 1:NP_001015257.2 Gene:CG17167 / 3354991 FlyBaseID:FBgn0039941 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_021333605.1 Gene:slc8b1 / 560601 ZFINID:ZDB-GENE-130530-900 Length:301 Species:Danio rerio


Alignment Length:246 Identity:68/246 - (27%)
Similarity:104/246 - (42%) Gaps:47/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DEG---SPMDEFADLFTVDQLRQGWVVLHVFAAVYFFILLAIICNDYFLPTVECICEDLHLSKDV 122
            |||   .|...|. |||...|... :.::|...::.|::|.:|.:|:|.|.:..|...|.|:.:|
Zfish    79 DEGFIKYPFVTFC-LFTPSLLPLA-ITIYVIWLLFLFLVLGLIASDFFCPNLSAIASTLRLTHNV 141

  Fly   123 AAATFMATATSMPEFFTNTISTLILES-----DMGLGTIIGSLMFNTLGVAGLAALAIDKPVQLD 182
            |..||:|.....|:.|    |.:...|     .:.:|.:.|:.:|.|..|||..||.  ||..:.
Zfish   142 AGVTFLALGNGAPDVF----SAMAAFSHPQTAGLAIGALFGAGIFVTTVVAGSVALV--KPFTVA 200

  Fly   183 WWPIARDCFIYVFNTIILLVLAWSGSISFTESCIMMGFLILYYLITFNNNKFMPAIRVFIEDRMN 247
            ..|..||...|:........:.:.|.||..||...:|..|.|.        |...:..:|.:|. 
Zfish   201 SRPFLRDVIFYMAAVFWTFTVLYKGHISLGESVGYLGMYIAYV--------FTVILSSYIYNRQ- 256

  Fly   248 CCFSTRYDLTEPPENSAKAQLPLKKDPLSGD-------------GLFVLNL 285
                 ::.|||.|::|.:.|..:    ||.|             .||:|||
Zfish   257 -----KHQLTESPQSSDREQGGI----LSSDLTYRETVSIQAHGVLFLLNL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17167NP_001015257.2 TIGR00367 85..503 CDD:273039 59/219 (27%)
Na_Ca_ex 86..229 CDD:279963 42/147 (29%)
Na_Ca_ex 356..509 CDD:279963
slc8b1XP_021333605.1 Na_Ca_ex 66..>246 CDD:332332 52/182 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.